(data stored in ACNUC7421 zone)

EMBL: AP010803.PE301

AP010803.PE301       Location/Qualifiers
FT   CDS_pept        complement(318071..318430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03010"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95135"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXQ3"
FT                   /protein_id="BAI95135.1"
FT                   /translation="MRMRKDRPPLRIRINRHEARCVEAHTGRARFSTRRVSIQLNQIAA
FT                   LDSLVFRDFLIRDRFRSLGNRPRQRGQIQDLPDRLMRVDSRHSPFRHPGLDPGSRFLSE
FT                   SAPGSRQRDPGSSPG"
     ttgcggatgc gaaaggatcg cccgcccctt cgcatccgca tcaatcgcca tgaagcgcgc        60
     tgcgttgaag cccatacagg ccgcgcgcgc ttttccacgc gacgggtttc gatccaattg       120
     aatcagattg ccgctctgga ttccttagtt ttccgcgatt tcctaatcag ggatcggttc       180
     cgatcgcttg gaaatcgccc taggcagcgt ggacaaattc aagacttgcc ggaccggctt       240
     atgcgggtgg attcccgcca ttcccccttt cgtcaccccg ggcttgaccc ggggtcccgc       300
     tttctttctg agtccgcgcc cggctcaagg cagcgggacc ccggatcaag tccggggtga       360
//

If you have problems or comments...

PBIL Back to PBIL home page