(data stored in ACNUC7421 zone)

EMBL: AP010803.PE302

AP010803.PE302       Location/Qualifiers
FT   CDS_pept        318563..318904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03020"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95136"
FT                   /db_xref="InterPro:IPR030972"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXQ4"
FT                   /protein_id="BAI95136.1"
FT                   /translation="MTRKTLVALTAAITLALPAANAFAGINDMDVVVDGRTGMETRSIA
FT                   VSMADLNLASTHGVRMADSRITKAAKKVCGWMSGSILPATPDYRACFGEALDGARSDLD
FT                   TLIQAQRQG"
     atgaccagaa agacgttggt ggcgctgacc gccgcgatta cccttgcctt gcccgcagcg        60
     aatgcctttg ccggcatcaa cgatatggac gtggtggtcg acggccgcac cgggatggaa       120
     acccgcagca tcgccgtgtc gatggctgac ctgaaccttg ccagcaccca tggcgtgcgc       180
     atggccgatt cccgcatcac caaggccgcc aagaaggtct gcggctggat gagcggatcg       240
     atcctgcccg ccacgcccga ctatcgcgcc tgcttcggcg aagcgctgga cggcgcccgc       300
     tcggacctcg acacgctgat ccaggcccag cgccagggct ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page