(data stored in ACNUC7421 zone)

EMBL: AP010803.PE304

AP010803.PE304       Location/Qualifiers
FT   CDS_pept        320582..321001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03040"
FT                   /product="hypothetical protein"
FT                   /note="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03040"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95138"
FT                   /db_xref="GOA:D4YXQ6"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXQ6"
FT                   /protein_id="BAI95138.1"
FT                   /translation="MPYWVRNMAGPFNAVFGRFTFTRYLLASICALSADFALFMLLHRL
FT                   GASPALAALGGYSGGLVLHWMISTQFVFEMRKPPTHGQRIAFILSALIGMAITMGLVGG
FT                   LSGLGLPPAMAKLAAVPVSFLSVYAIRKYGIFARA"
     atgccttatt gggtgcggaa catggccggg ccgttcaacg ccgtcttcgg ccgtttcacc        60
     ttcacgcgct atctgctggc cagcatctgc gcgctgtcgg ccgatttcgc gctgttcatg       120
     ctgcttcacc ggctgggcgc gtcgcctgcc ctcgcggcat tgggcggcta ttcgggcggg       180
     cttgtcctgc actggatgat cagcacgcag ttcgtgttcg agatgcgcaa gccccccacc       240
     catgggcagc gcatcgcctt catcctgagc gccctgatcg gcatggcgat caccatgggg       300
     ctggtgggcg ggctgagcgg cctggggctt ccgcccgcca tggccaagct ggcggccgtg       360
     ccggtcagct tcctgtcggt ctatgcgatc cggaaatatg gcatcttcgc ccgcgcctga       420
//

If you have problems or comments...

PBIL Back to PBIL home page