(data stored in SCRATCH zone)

EMBL: AP010803.PE305

AP010803.PE305       Location/Qualifiers
FT   CDS_pept        320979..322829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03050"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03050"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95139"
FT                   /db_xref="GOA:D4YXQ7"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXQ7"
FT                   /protein_id="BAI95139.1"
FT                   /translation="MASSPAPDGGSPSRTASLARWQICVAALLLWALCCAVMLWLFRNG
FT                   LTTLEFRDPDDAMRLQQVRDWLHGQTFRDVSQHRVNPPAGGPMHWSRIVDMPIAALILM
FT                   LQPLLGPVRAELAACALVSLLLLGGLTATVFLAARRAAGGLFVPMLAVVLLLTTPTILV
FT                   QFTPFRIDHHGWQIWMAAVALCGALDARRLRGGVTAGLALAVWLQISSEALPYAALFAG
FT                   AFALRTWFDRREAARIAAYAVTLGGGALLLLLLLRGPGAVLARYCDGLSAAYIWPLLAF
FT                   ALAMPLALRLIGATTVRRRFMATAAAGGAAAGVFLLSGGACLSGDPFKALGPVAYRLWY
FT                   LQVKEGRPIWEQGLLMAGIILLPAVMGLASTIVAAWRAPEREARDRWIVIALLLAGALA
FT                   VAILVLRAMSVAHVLALPGTAWLLLATFQHIQGWSRAVARILVTASVAILLTPAGLCGA
FT                   WILIASGAAEKEQPETVNCRTAALLAPLRALPRSTLFAPLDLGPDILVRTGHSVIGTAH
FT                   HRNATGINAVIDGFTQPPDKALTTIMRLNGGKGPDYLLTCNDMNEIKHYRADFPQGLAA
FT                   ALKRDKPPRWLRPVPSKGPLRIYKVIAQPATKASATPFMQ"
     atggcatctt cgcccgcgcc tgacggcggc tccccttcca ggacggcatc cctcgcccgc        60
     tggcagattt gcgtcgcggc gctgctgctc tgggccttgt gctgcgccgt catgctctgg       120
     ctgttccgca acgggctgac cacgctcgaa ttccgcgatc ccgatgacgc catgcggctg       180
     caacaggtcc gcgactggct gcacggccag accttccggg atgtcagcca gcaccgggtg       240
     aaccccccgg caggcgggcc gatgcactgg tcgcgcatcg tcgacatgcc gatcgccgcc       300
     ctgatcctga tgctgcaacc gctgctgggg cctgtgcgcg ccgaactggc ggcctgcgcg       360
     ctggtgtcgc tgctgttgct ggggggattg acggccacgg tcttcctggc ggcgcggcgc       420
     gctgccggcg gcctcttcgt cccgatgctg gcggtcgtgc tgctgctgac cacgccgacc       480
     atcctggtcc agttcacgcc gttccggatc gaccatcacg ggtggcaaat atggatggcg       540
     gccgtggcgc tgtgcggcgc gctggatgcc cgccgcctga gggggggcgt cacggccggc       600
     ctcgcgctgg cggtgtggct tcagatttcc agcgaggcgc tgccctatgc ggccctgttc       660
     gccggcgcct tcgcgctgcg gacctggttc gaccggcggg aggcggcgcg catcgccgcc       720
     tatgccgtca cgctgggcgg cggcgcgctc ctgctcctgc tgctgctgcg cggccccggc       780
     gcggtgctgg cccgatattg cgacgggctt tcggcggcct atatctggcc gctcctggcc       840
     ttcgcgctgg cgatgccgct ggcgctgcgc ctgatcggcg cgacgaccgt tcggcggcgc       900
     ttcatggcga cggcggcggc aggcggcgcg gcggcgggcg tgttcctgct gagcggcggg       960
     gcctgcctgt ccggcgaccc gttcaaggcg ctcggcccgg tcgcctatcg cctatggtat      1020
     ctccaggtga aggaaggccg cccgatctgg gagcagggcc tgttgatggc cgggatcatc      1080
     ctgttgccgg cggtcatggg gctggccagc acgattgtcg cagcctggcg cgccccggaa      1140
     cgggaggcgc gggaccgctg gatcgtcatc gccctgctgc tggccggagc gctggcggtc      1200
     gcgatcctcg tgctgcgcgc catgtcggtg gcgcatgtcc tggcgctgcc cggcacggcc      1260
     tggctgctgc tggcgacgtt tcagcatatc cagggctgga gcagggcggt ggcgcgcata      1320
     ttggtgacgg cgagcgtcgc catattgctc accccggcgg gcctgtgcgg cgcctggata      1380
     ttgatcgcga gcggcgcggc ggaaaaggag cagcccgaaa ccgtcaattg ccggacggcg      1440
     gcgctgctgg cccccctgcg ggcgctgccc cgatcgaccc tgttcgcgcc gctcgatctg      1500
     gggccggaca tcctcgtgcg gaccgggcac agcgtgatcg gcacggccca tcaccgcaac      1560
     gcgacgggca tcaacgcggt catagacggt ttcacgcagc cgccagacaa ggctttgacg      1620
     accatcatgc gcctgaacgg cggcaagggt ccggattacc tgctgacctg caacgatatg      1680
     aacgagatca agcattatcg cgccgatttc ccgcaagggc tggccgcggc attgaagcgc      1740
     gacaagccgc cgcgctggtt gcggccggtc cccagcaagg ggccgctccg catctacaag      1800
     gtgatcgctc agccggcgac aaaggccagc gcgacgccgt tcatgcagta a               1851
//

If you have problems or comments...

PBIL Back to PBIL home page