(data stored in SCRATCH zone)

EMBL: AP010803.PE306

AP010803.PE306       Location/Qualifiers
FT   CDS_pept        complement(322787..323272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrB"
FT                   /locus_tag="SJA_C1-03060"
FT                   /product="peptide-methionine (R)-S-oxide reductase"
FT                   /EC_number="1.8.4.12"
FT                   /note="putative methionine sulfoxidereductase, SelR /
FT                   conserved domain frequently associated with peptide
FT                   methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03060"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95140"
FT                   /db_xref="GOA:D4YXQ8"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXQ8"
FT                   /protein_id="BAI95140.1"
FT                   /translation="MAGPMNRRRFLGMGGCAATMIVLWQAGLGRAAAYPFTLSDAEWRR
FT                   RLSPLAYQVLRKRSTEHPFTSPLNKEHRPGVFACAGCGQRLFSSKTKFDSGTGWPSFWA
FT                   PLPRAVGTSRDFELGYPRTEVHCARCGGHLGHVFDDGPKPTGKRYCMNGVALAFVAG"
     atggcgggcc ccatgaaccg gcggcgattc ctgggcatgg gcggctgcgc cgcgacgatg        60
     atcgtcctct ggcaggccgg gctgggcagg gccgccgcct atcccttcac gctcagcgat       120
     gccgaatggc gccggcgcct cagcccgctc gcctatcagg tgctgcgcaa gcgatcgacc       180
     gaacatccct tcaccagtcc gctcaacaag gaacatcgcc ccggcgtctt tgcctgcgcc       240
     ggttgcgggc aacggctttt cagttcgaag accaagttcg acagcggcac gggctggccc       300
     agcttctggg cgccgctgcc ccgcgccgtc ggcacctcgc gcgatttcga actgggctat       360
     ccgcggaccg aggtgcattg cgcgcggtgc ggcgggcatc tgggccatgt gttcgatgac       420
     gggccgaagc ccaccggcaa gcgttactgc atgaacggcg tcgcgctggc ctttgtcgcc       480
     ggctga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page