(data stored in ACNUC7421 zone)

EMBL: AP010803.PE309

AP010803.PE309       Location/Qualifiers
FT   CDS_pept        325467..326489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03090"
FT                   /product="putative Fe-S protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03090"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95143"
FT                   /db_xref="GOA:D4YXR1"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXR1"
FT                   /protein_id="BAI95143.1"
FT                   /translation="MEQRLKAEARRLGFAACAIAPANAAPRSAERLRQWLDAGHHGEML
FT                   WMEERAGQRGSPQGLWPDVRSVVMLGMSYAPGRDPLALADARDRGRISVYAQGRDYHDV
FT                   VKKGLKALARWLVEQHPGALKVFVDTAPVMEKPLAQAAGLGWQGKHSNLVSRTHGSWLF
FT                   LGAIYSEIALVPDAPEDDHCGSCTACQTACPTDAFPAPYVVDARRCISYLTIEHKGPIP
FT                   EELRAGIGNRVYGCDDCLAVCPWNKFADAAAANRAFVGRAELAAPELGDLLALDDAGFR
FT                   EIFAGSPIKRIGRNRMVRNAAIAAGNSGDRRLVGRLQALAAADDPVVAEAARWALERLG
FT                   "
     ttggaacagc ggcttaaggc cgaagcgcgg cggctgggct ttgccgcctg cgccatcgcg        60
     cccgccaacg ccgcgccgcg ttcggccgaa aggctgcggc aatggctgga tgcgggccat       120
     catggcgaga tgctgtggat ggaggaacgc gccgggcagc gcggatcgcc gcaagggctc       180
     tggccggacg tgcgcagcgt cgtgatgctg gggatgagct atgcgccggg gcgcgatccg       240
     ctggcgctgg cggacgcgcg cgaccggggc cggatttcgg tctatgcgca ggggcgcgac       300
     tatcatgacg tggtcaagaa ggggctgaag gccctcgccc gctggctggt ggagcagcat       360
     cccggcgcgc tcaaggtctt cgtcgatacc gccccggtga tggaaaagcc gctggcgcag       420
     gccgcgggcc tcggctggca ggggaagcac agcaacctcg tcagccggac gcatggaagc       480
     tggctgttcc tgggcgcgat ctacagcgag atcgcgctgg tccccgacgc gccggaggat       540
     gaccattgcg gcagttgcac cgcctgccag acggcctgcc cgaccgacgc ctttcccgcc       600
     ccctatgtgg tcgatgcgcg gcggtgcatc tcctacctca ccatagagca taaggggccg       660
     attccggagg agttgcgcgc cgggatcggc aatcgcgtct atggctgcga cgattgcctg       720
     gcggtgtgcc cgtggaacaa gtttgcggat gcggcggcgg cgaacagggc ctttgtcggg       780
     cgggcggaac tggcggcgcc ggaactgggc gacctgctgg cgctggacga tgcgggcttt       840
     cgcgagattt tcgccggctc ccccatcaag cggatcgggc ggaaccggat ggtgcgcaat       900
     gccgccatcg ccgcggggaa cagcggcgac aggcggttgg tgggccggtt gcaggcgctg       960
     gcggcggccg acgatccagt ggtggcggag gcggctcgct gggcgctgga gcggttgggc      1020
     tag                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page