(data stored in SCRATCH zone)

EMBL: AP010803.PE31

AP010803.PE31        Location/Qualifiers
FT   CDS_pept        complement(31319..31579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00310"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94865"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWY3"
FT                   /protein_id="BAI94865.1"
FT                   /translation="MKVSVDVDCTPAEARAFLGLPDVTPIHDKYVKTMLDSFDGVANVE
FT                   QMETLFRSFSPLGDAGMRLFKQMMDIGLAGMPGKNGDKNPG"
     atgaaggtaa gcgtggacgt cgactgcact cctgcggagg cccgggcttt cctggggctg        60
     ccggatgtca cccccattca cgacaaatat gtaaaaacga tgctcgacag cttcgacggc       120
     gtcgccaatg tcgagcagat ggaaacgctg ttcaggagtt tttcgccctt gggcgatgcc       180
     gggatgcgcc tgttcaaaca gatgatggac atcggccttg cggggatgcc gggcaagaat       240
     ggcgacaaga atccaggctg a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page