(data stored in SCRATCH zone)

EMBL: AP010803.PE310

AP010803.PE310       Location/Qualifiers
FT   CDS_pept        complement(326556..326930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03100"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95144"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXR2"
FT                   /protein_id="BAI95144.1"
FT                   /translation="MTRPHPALVLASLLTLAACGGVVPPPATQIARPPAGPPASAFTRP
FT                   GPLIGSDAKQLMRLFGQPRLDIRESAMRKLQFANGRCVLDAYLYLPPQGKEPLVTHVDA
FT                   RTPTGTDVDAASCSAALQAK"
     atgacccgtc cccatccggc gctcgtcctg gcttcgctct tgaccctggc cgcttgcgga        60
     ggcgtcgtgc cgccgcccgc gacccagatc gcccggccgc ccgccggtcc tccagccagc       120
     gccttcaccc gcccaggccc cctgatcggg tcggacgcga agcagctcat gcgcctgttc       180
     ggccagcccc ggctcgacat tcgcgaaagc gccatgcgca agctgcaatt cgccaatggc       240
     cgctgcgtgc tggacgccta tctctacctg ccgccgcagg ggaaggagcc gctcgtcacc       300
     catgtcgatg cgcgcacgcc cacgggcacg gatgtcgacg cggcgagctg ctcggcggcg       360
     ttgcaggcga agtga                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page