(data stored in ACNUC7421 zone)

EMBL: AP010803.PE311

AP010803.PE311       Location/Qualifiers
FT   CDS_pept        complement(326927..327607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03110"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein involved in cysteine
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03110"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95145"
FT                   /db_xref="GOA:D4YXR3"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXR3"
FT                   /protein_id="BAI95145.1"
FT                   /translation="MVLAAALRAFPSIFHGAALRLLVKTLLLTLLAFALLAAALWTGIH
FT                   AARLHFGWATGAGWGGLAEATATAIAVIAVGWLLFRATAMAIMSLFADDIIVAVERDSY
FT                   TAAAARARPVGWGRSLGFALRSVLRTLGWNLLALPAYLLLLVTGIGTLGLFLILNAALL
FT                   GRDMADMVEPRHPDLPPIPRGGRWLMGLASALIFLVPGLNLLAPIWSAAMAVHMLHGAR
FT                   RNMP"
     atggtccttg ccgccgccct tcgcgccttt ccctccatct tccatggcgc cgcgctgcgg        60
     ctgctggtca agacgctgct gctgaccctg ctcgccttcg cgctcctcgc cgccgccttg       120
     tggaccggca tccacgccgc ccgactgcat ttcggctggg cgacgggcgc gggctggggc       180
     gggctggcgg aggcgaccgc gaccgccatc gccgtgatcg ccgtcggctg gctgctgttc       240
     cgcgccaccg ccatggcgat catgagcctc tttgccgacg acatcatcgt cgccgtcgag       300
     cgggacagct ataccgcggc ggccgcccgc gcccggccgg tcggctgggg gcgcagcctg       360
     ggtttcgcgc tgcgctccgt cctgcggacc ttgggctgga acctgctcgc cctgccggcc       420
     tatctgctgc tgctggtgac ggggatcggc acgctgggcc tgttcttgat cctgaacgcc       480
     gccctgctcg gccgcgacat ggccgacatg gtcgagccgc gccatcccga cctgccgccg       540
     atcccgcgcg gcggccggtg gctcatgggc ctcgcttcgg cgctgatctt cctggtgccg       600
     ggcctcaacc tgcttgcgcc gatctggagc gcggctatgg cggtccacat gctgcacggt       660
     gcccgaagga acatgccatg a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page