(data stored in SCRATCH zone)

EMBL: AP010803.PE313

AP010803.PE313       Location/Qualifiers
FT   CDS_pept        complement(328759..330255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03130"
FT                   /product="putative polysaccharide transporter"
FT                   /note="membrane protein involved in the export of O-antigen
FT                   and teichoic acid"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03130"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95147"
FT                   /db_xref="GOA:D4YXR5"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXR5"
FT                   /protein_id="BAI95147.1"
FT                   /translation="MAAEGASPAQQDDIAALAKGGRTNVFGFLLRLAARLPFLFIAGRW
FT                   YGADALGRFAYAVLVVEFVAQLATLGLKRGLAGALSQTERPHSHVVTDAMVVTLIASLI
FT                   GSALLVAFPQAMFPNSGINGLDRLLALIVIAVAGSDVALAACAYRFDIGATVRARSIIE
FT                   PWAISIGAFGFAYYSTRDGLILSYVVSMIAALVASIIPMTRHYGIPYGWRPDFGRLWRL
FT                   ARRNLPLAAADGVEWGSRRLDMAILGLFVSPAVVGIYYVAQQVASLPQKLKTSFDPILG
FT                   PVITRNLSEGNLTAIARQVSQVGFWIIAAQAGIALALGIPGEAVMGLVGPHFVGGTGAL
FT                   AFLLLAEVVAATAVVSESALVYIARHRNLMISLLMIVLQAALSFLLIFAARRLGLRDMA
FT                   VAAAPALALSIALGVSALVKARLLSTLLGARVNAWRWPLLSASGVACIVGAAFVALPPD
FT                   FEWVELVFGVFTILGVYGFVIWRWGFGPDDRALFRKQKAA"
     ttggcggctg aaggggcctc tcccgcgcag caggacgata ttgcggcgct cgccaagggt        60
     ggacggacca atgtgttcgg tttcctgctc cgcctggcgg cgcgcctgcc gttcctgttc       120
     atcgccggcc gctggtatgg cgccgacgcg ctgggccgct tcgcctatgc ggtgctggtg       180
     gtggagttcg tcgcgcagct tgcgacgctg ggcctgaagc gcggcctggc gggcgcgctc       240
     tcccagacgg agcggccgca cagccatgtc gtcaccgacg ccatggtggt gacgctgatc       300
     gcctccctga tcggcagcgc gctcctggtc gccttccccc aggccatgtt ccccaacagc       360
     ggcatcaacg gcctcgaccg cctgctcgcc ctgatcgtga tcgcggtcgc ggggtccgac       420
     gtggcgctgg ccgcctgcgc ctatcgcttc gacatcggcg ccacggtgcg ggcgcggtcc       480
     atcatcgaac cctgggcgat cagcatcggc gccttcggct tcgcttatta ttcgacccgc       540
     gacgggctga tcctctccta tgtggtctcg atgatcgccg cgctggtcgc ctcgatcatt       600
     ccgatgaccc gccattacgg cattccctat ggctggcgcc cggatttcgg gcggctgtgg       660
     cggctggcgc gccgcaacct gccgctggcg gcggcggacg gcgtggaatg ggggtcgcgc       720
     cggctggaca tggccattct gggcctgttc gtcagccccg ccgtggtcgg catctattat       780
     gtggcgcagc aggtcgcctc cctgccccag aaattgaaga ccagcttcga cccgatcctg       840
     ggcccggtca tcacccgcaa tctttcggag ggcaatctca ccgccatagc ccggcaggtg       900
     agccaggtcg gcttctggat catcgcggcg caggcgggca tcgcgctcgc gctcggcatt       960
     ccgggcgagg cggtgatggg cctggtcggc ccccatttcg tcggcggaac gggcgcgctc      1020
     gccttcctgt tgctggccga agtcgtggcg gcgaccgccg tggtcagcga atcggcgctg      1080
     gtctatatcg cccggcaccg caatctgatg atctcgctgc tgatgatcgt gcttcaggca      1140
     gcgctcagct tcctgctgat cttcgcggcg cggcgtttgg gcctgcgcga catggcggtc      1200
     gccgccgcgc ccgcgctggc gctcagcatc gcgctcggcg tcagcgcgct ggtcaaggcg      1260
     cgcctgcttt ccaccctgct cggcgccagg gtcaacgcct ggcgctggcc gctgctcagc      1320
     gcttccggcg tcgcctgcat cgtcggcgcg gcgttcgtcg cgctgccgcc cgatttcgaa      1380
     tgggtggaac tggtcttcgg cgtgttcacc atccttggcg tctatggctt cgtcatctgg      1440
     cgctggggct tcggcccgga cgaccgcgcg ctgttccgga agcagaaggc ggcctga         1497
//

If you have problems or comments...

PBIL Back to PBIL home page