(data stored in ACNUC7421 zone)

EMBL: AP010803.PE318

AP010803.PE318       Location/Qualifiers
FT   CDS_pept        333994..334878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03180"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95152"
FT                   /db_xref="GOA:D4YXS0"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXS0"
FT                   /protein_id="BAI95152.1"
FT                   /translation="MEEKPLMSDMDAPASGATGPLPARRGPWLLALLVLLAFAVGVVLT
FT                   VLALPRIQRWNAPQRPSVLSDPLLNAVAPGVPMRPLSADAGQMLDARVVQLEERLNRIT
FT                   VEAQAASGNAARAEGLLVAFAARRALDSGASLGYIEGQLRLRFGQAQPRAVATIINAAR
FT                   EPVTLPDLRAGLTALADQVTVPPANASWWEALEHEAREIITIHRASTPSPRPQAALDRA
FT                   LRYLDGSRVGAALAEVEQMPGRAAADRWMQYARRYMEARRALDLIETAAILEPRQLRAA
FT                   DGAAVAQTSPLAP"
     atggaagaaa agcccttgat gagcgatatg gacgccccgg cgagcggcgc gacggggccc        60
     ctcccggcgc ggcgcggacc ctggctgctg gccctgctgg tcttgctcgc ctttgcggtc       120
     ggggtcgtgc tgaccgtcct cgccttgccg cgcatccagc ggtggaatgc gccgcaacgg       180
     ccatcggtgc tgagcgatcc gctgctgaac gccgtcgcgc cgggcgtgcc gatgcgtccg       240
     ctttccgccg atgccgggca gatgctggac gcgcgggtcg tgcaactgga ggaacggctg       300
     aaccgcatca cggtggaggc gcaggcggcg tcgggcaatg cggcgcgggc ggaaggcctg       360
     ctggtcgcct tcgcggcgcg gcgggcgctc gatagcgggg cgtcgctcgg ctatatagag       420
     ggccagttgc gcctgcgttt cggccaggcg cagccgcgcg cggtggcgac gatcatcaac       480
     gccgcgcggg agccggtgac gctgcccgac ctgcgcgccg ggctgacggc gctcgccgac       540
     caggtcaccg ttccccccgc caatgcaagc tggtgggaag cgctggagca tgaggcgcgg       600
     gagatcatca ccatccaccg ggcgtccacc ccctctcccc ggccgcaggc ggcgctggac       660
     cgggcgctgc gctatctgga cggatcgcgg gtcggcgcgg cgctggcgga ggtggagcag       720
     atgccggggc gcgccgccgc cgaccgctgg atgcaatatg cgcggcgcta catggaggcg       780
     cggcgggcgc tggacctgat cgagacggcc gcgatattgg agccgcgcca gttgcgggcg       840
     gccgatggcg ctgcggtcgc gcagacctct ccgctggcgc cctga                       885
//

If you have problems or comments...

PBIL Back to PBIL home page