(data stored in ACNUC7421 zone)

EMBL: AP010803.PE319

AP010803.PE319       Location/Qualifiers
FT   CDS_pept        335002..335751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03190"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95153"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXS1"
FT                   /protein_id="BAI95153.1"
FT                   /translation="MPPYADAIASFWKARLASGPRAAERPPLQHLLGNASLPFDLARTR
FT                   ARAPQLAQAIRGDGRRILLIPGLLASEHRMEPLRAVLNAAGYEAHGWGMGRNFGPRPDS
FT                   LEQIDRRVDAIRRETGAPVTLVGWSLGGLFAREYAKFATRKVGGVVTMGTPFSGDPRAN
FT                   HAWRLYQLVSGFPVDRPPFTCRREEKPPVPTVALWSRRDGVILPRCAKGRAGERDRAIE
FT                   VDCTHMGFAAAPEGILAVGEALEAMRG"
     gtgcccccct atgccgacgc catcgccagt ttctggaagg cccgtttggc cagcggcccc        60
     cgcgcagccg agcggccgcc gctccagcac ctgttgggca atgcgtcctt gcccttcgat       120
     ctggcgcgga cgcgggcgcg ggcgcctcaa ctggcgcagg cgatccgcgg cgatgggcgg       180
     cggatactgc tgattcccgg cctgctggca agcgagcatc ggatggagcc tctgcgcgcc       240
     gtgctcaatg cggctggata tgaggcgcat ggctggggca tgggccggaa tttcggaccc       300
     aggccagaca gcctggagca gatcgaccgc cgggtggacg ccataaggcg ggagaccgga       360
     gcgcccgtga ccctggtggg atggagcctg ggcgggctgt tcgcgcgcga atatgccaaa       420
     ttcgccacgc gcaaggtcgg cggcgtggtg acgatgggca cgcccttttc cggcgatccg       480
     cgcgccaacc atgcctggcg gctctatcag ctcgtttccg gatttcccgt cgaccggccg       540
     cccttcacct gccggcgcga ggaaaagccg ccggtgccga cggtcgcgct ctggtcgcgg       600
     cgggacggcg tgatcctgcc ccgatgcgcc aagggacgcg ccggggagcg cgaccgggcg       660
     atcgaggtcg actgcacgca tatgggcttc gccgcagcac cggagggtat tttggcggtg       720
     ggcgaggcgc tggaggccat gcggggctga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page