(data stored in ACNUC7421 zone)

EMBL: AP010803.PE32

AP010803.PE32        Location/Qualifiers
FT   CDS_pept        31738..32436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00320"
FT                   /product="carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="dienelactone hydrolase or related enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00320"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94866"
FT                   /db_xref="GOA:D4YWY4"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWY4"
FT                   /protein_id="BAI94866.1"
FT                   /translation="MAAFTSIPTLEGDARFDVFVARPEGAPKAAIVVIQEIFGVNEGIR
FT                   RKCDSWAAAGYLAMAPDLFWREKPHVELDADIGEELQAAFGHMQKFNQDQGIRDIEATI
FT                   KAARAELGQGGKVGLVGYCLGGRLAFMSACRTDGDAFVAYYGVGIDGLLNEQHAIGKPV
FT                   LLHVPTADGFVPPDVQRKMHEGLKDNRHVTLHDYEGLDHGFAAEMGARRNEAAAQLADG
FT                   RTADFFAAHL"
     atggcagcat tcacatccat ccccacgctg gagggcgatg cccgcttcga tgtctttgtc        60
     gcccggccgg agggcgcgcc caaggccgcg atcgtcgtaa tccaggaaat cttcggcgtg       120
     aacgagggca tccgccgcaa atgcgatagc tgggcggcgg ccggctatct ggccatggcg       180
     cccgatctgt tctggcgcga aaagccgcat gtcgaactcg acgccgacat aggcgaggag       240
     cttcaggcgg ccttcggcca tatgcagaaa ttcaaccagg atcagggcat tcgcgacata       300
     gaggccacga taaaggccgc ccgggccgaa ttggggcaag gcggcaaggt cggcctggtc       360
     ggatattgcc tgggcgggcg gctggcgttc atgtcggcct gccgcaccga cggcgatgcc       420
     ttcgtggcct attatggcgt cggcatcgac ggcctgctga acgaacagca tgccatcggc       480
     aagccggtgc tgctgcatgt ccccaccgcc gacggctttg tcccgcccga cgtgcagcgc       540
     aagatgcatg aagggctgaa ggacaatcgc catgtcacgc tgcacgatta tgaggggctg       600
     gaccatggct tcgcggccga aatgggggcg cgccgcaatg aggcggcggc gcagcttgcc       660
     gacggccgga ccgcggattt cttcgcggcc catctctga                              699
//

If you have problems or comments...

PBIL Back to PBIL home page