(data stored in ACNUC7421 zone)

EMBL: AP010803.PE323

AP010803.PE323       Location/Qualifiers
FT   CDS_pept        complement(340186..340422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03230"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95157"
FT                   /db_xref="GOA:D4YXS5"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXS5"
FT                   /protein_id="BAI95157.1"
FT                   /translation="MALIGWIASFMALFGGVALWQDMPSDGSPALANILFMLALLTCPW
FT                   LWRDKPLGISLSQRIFLAMALLCSLPLLLFPRN"
     gtggcgctga tcggctggat tgcgagtttc atggccctgt tcgggggggt ggcgctgtgg        60
     caggatatgc cgtccgacgg ctcgcccgca ttggcgaaca tcctgttcat gctggccctg       120
     ctgacctgcc cctggctgtg gcgcgacaag ccgctgggca tatcgctcag ccagcgcatc       180
     ttcctggcca tggcgctgct atgcagcctg ccgctgctgc tgtttccgcg caactga          237
//

If you have problems or comments...

PBIL Back to PBIL home page