(data stored in ACNUC7421 zone)

EMBL: AP010803.PE324

AP010803.PE324       Location/Qualifiers
FT   CDS_pept        complement(340478..340909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03240"
FT                   /product="glyoxalase-family protein"
FT                   /note="glyoxalase / bleomycin resistance protein /
FT                   dioxygenase / uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03240"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95158"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXS6"
FT                   /protein_id="BAI95158.1"
FT                   /translation="MMPGSPVIPALRYADAPAAIRFLCQAFGFEVQASYEDAEDPHIIH
FT                   HAQLVLGEGMVMLGSARDGEAESLYSWTTPRELGGVTACIYVVVPDADAHCLHARNEGA
FT                   VVVSEPHDNDGYPGRGYEALDPEGNVWSFGTYDPWAHFA"
     atgatgcccg gttctcccgt catccccgcg ctgcgctatg ccgacgcgcc cgccgccatc        60
     cggtttctct gccaggcctt cggattcgaa gtgcaggcca gttacgagga cgcggaggat       120
     ccgcatatca tccaccatgc ccaactcgtg ctgggggaag gcatggtcat gctgggcagc       180
     gcccgcgacg gcgaggcgga gtcgctctac agctggacca cgccccgcga actgggcggc       240
     gtcaccgcct gcatctatgt ggtcgtgccc gatgccgacg cccattgcct ccatgcccgg       300
     aacgaaggcg ccgtggtggt cagcgagccg catgacaatg acggctatcc cggacgcggc       360
     tatgaggcgc tggacccgga aggcaatgtc tggagcttcg gcacttacga tccctgggct       420
     catttcgcct aa                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page