(data stored in ACNUC7421 zone)

EMBL: AP010803.PE325

AP010803.PE325       Location/Qualifiers
FT   CDS_pept        341035..341820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03250"
FT                   /product="putative fructose-1,6-bisphosphatase"
FT                   /EC_number="3.1.3.11"
FT                   /note="archaeal fructose-1,6-bisphosphatase or related
FT                   enzyme of inositol monophosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03250"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95159"
FT                   /db_xref="GOA:D4YXS7"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR011809"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXS7"
FT                   /protein_id="BAI95159.1"
FT                   /translation="MTTRDDLALANRLADAARAAIRPFFRARYDMEFKSDQSPVTEADR
FT                   AAEAAIRAILEKERPQDGIIGEEYGAAREDAERVWILDPIDGTRSFIAGRPIFGTLIAL
FT                   TQAGWPTIGIIDQPIADERWAGMMGQPTTFNGRPVTTRACRALDQAILASTAPQLFPGC
FT                   TAEHFSRLAGQCRDTVWGGDCYNYGLVASGHVDIVVEAGLKLHDLAALVPVVEGAGGRM
FT                   CDWAGEPLTHDSDGRVIALGDAARLDDVLEALAEGHEDH"
     atgacgaccc gcgacgacct ggcccttgcc aaccgccttg ccgacgccgc ccgcgcggcg        60
     atccgcccct ttttccgcgc gcgctacgac atggaattca aatccgacca gtcccccgtg       120
     acggaggcgg accgggcggc ggaagcagcg atccgcgcga tcctggaaaa ggaacggccg       180
     caggacggca tcatcgggga ggaatatggc gcggcccgcg aggatgcgga gcgagtatgg       240
     atcctcgatc ccatcgacgg cacgcgcagc ttcatcgccg ggcggccgat cttcggcacg       300
     ctgatcgcgc tgacgcaggc gggttggccc accatcggga tcatcgacca gcccatagcg       360
     gacgaacgct gggcggggat gatggggcaa ccgacgacct tcaacggcag gccggtgacg       420
     acccgcgcct gccgcgccct ggaccaggcg atcctggcct ccaccgcgcc gcagcttttc       480
     cccggctgca ccgccgagca tttctcgcgc cttgcggggc agtgccgcga caccgtctgg       540
     ggcggcgact gctataatta cggactggtc gcgtccggcc atgtcgacat cgtggtcgag       600
     gcagggctga agctgcacga tctggcggcg ctggtgccgg tggtcgaggg cgcgggcggg       660
     cggatgtgcg actgggccgg cgaaccgctc acccatgaca gcgacggccg ggtgatcgcg       720
     cttggcgacg cggcgcggct ggacgatgtg ctggaggcgc tggccgaggg gcatgaggat       780
     cattag                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page