(data stored in ACNUC7421 zone)

EMBL: AP010803.PE327

AP010803.PE327       Location/Qualifiers
FT   CDS_pept        complement(343860..344276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03270"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95161"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXS9"
FT                   /protein_id="BAI95161.1"
FT                   /translation="MRPWILGSGLCLAPLLLAGCSGTHEPPRLTEKQTSELERALAGKV
FT                   PGEKTSCVNRESQSNLTAISNSVLLYRVSRRLVYRNDLIGSCSGLSRGDTLIIRTWGSQ
FT                   YCRGDQITSADLMTGMVTGNCALGDFTPYRAPSK"
     atgcgtccgt ggatattggg ttccggcctg tgtctggccc cgctgctgct ggcgggatgt        60
     tcgggcactc atgagccgcc caggctgacc gaaaagcaga caagcgaact ggagcgcgcc       120
     ctggccggca aggtgcccgg cgaaaagacg agctgcgtca atcgggaatc ccagtccaac       180
     ctgacggcca tcagcaacag cgtcctgctg taccgggtca gccggcggct ggtctatcgc       240
     aacgacctga tcggcagttg ttccgggctg tcgcggggcg acacgctgat catcaggacg       300
     tggggatcgc aatattgccg cggggaccaa ataaccagcg ccgacctgat gaccggcatg       360
     gtgacgggaa attgcgcgct gggcgacttc acgccctatc gcgcgccgtc gaaatag          417
//

If you have problems or comments...

PBIL Back to PBIL home page