(data stored in ACNUC7421 zone)

EMBL: AP010803.PE330

AP010803.PE330       Location/Qualifiers
FT   CDS_pept        345596..346300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03300"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03300"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95164"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="InterPro:IPR016907"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXT2"
FT                   /protein_id="BAI95164.1"
FT                   /translation="MALTYHDKLLLGCAAVLALGMVGGGYLLGDGLKRARAADRSVTVR
FT                   GLAEKDVTADLATWSISYSATGFDLPAVRAEIDNNTRELRAYFASLGFKPDALTATGAG
FT                   VNQYINNGVNTITITQRMLLRTTDIARAQRAVAQQFDLVRRGVTLQEGSGMRYSFTRLN
FT                   DVKPPMVAAATRDARAAAEQFARDSGASVGGIKSATQGYFSIEARDGEADGSSDTPYKK
FT                   VRVVTTVDFYLN"
     atggccttaa cttatcatga caagctgctc ctgggatgcg cggccgtgct ggctctgggc        60
     atggtcggcg gcggctatct gctgggcgac gggctcaagc gggccagggc ggcggaccgg       120
     tccgtcaccg tgcgcggact ggcggaaaag gacgtgaccg cggacctcgc cacctggtcg       180
     atcagctatt ccgccaccgg gttcgacctg cccgccgtcc gggcggagat cgacaacaac       240
     acgcgggaac tgcgcgccta tttcgccagc ctgggcttca agccggatgc gctgaccgcg       300
     accggcgcgg gggtcaacca atatatcaac aatggcgtca acacgatcac catcacccag       360
     cgcatgttgc tgcgcacgac cgacatcgcc cgcgcccagc gggccgtggc ccagcaattc       420
     gatctggtcc ggcgcggcgt caccctgcag gagggatcgg gcatgcgcta cagcttcacc       480
     cggctcaacg acgtgaagcc cccgatggtc gccgccgcga ccagggacgc ccgcgccgcc       540
     gccgaacagt tcgcccgcga cagcggcgcc agcgtcggcg gcatcaagag cgcgacccag       600
     ggctatttct cgatagaagc gcgcgacggc gaggccgacg ggtcgagcga tacgccctac       660
     aagaaggtgc gcgtcgttac gacggtcgac ttctatctca actga                       705
//

If you have problems or comments...

PBIL Back to PBIL home page