(data stored in ACNUC7421 zone)

EMBL: AP010803.PE332

AP010803.PE332       Location/Qualifiers
FT   CDS_pept        complement(346591..347445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03320"
FT                   /product="TPR repeat protein"
FT                   /note="FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03320"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95166"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXT4"
FT                   /protein_id="BAI95166.1"
FT                   /translation="MPFLLPLLLLAPQAYDPEVEAVMNRKRKERAEASAVVAPVAQASD
FT                   GRIPVPDRYAAKFQACLDQAAEAPDKGVAFAQQWRIEGGSFYARNCMGFAYARAERWAP
FT                   AIVAFEQGADEAERNGEMAQSARLWAQAGNAALAGGDAAKARDDFDAALARGLPDGMEK
FT                   GEVHLDRARALVALNDGGSARASLDIALEQVPQDPLAWLLSATLARRSGEMKLAQAHIA
FT                   RAVQLSPDDASVALEEGNIAILTDHEDVARSAWQRAVKLAADAPAGRAAADNLSRLPPK
FT                   PAD"
     atgcccttcc tcctcccgct gctgctgctc gccccccagg cctatgatcc ggaggtcgag        60
     gcggtgatga accgcaagag gaaggaaagg gcggaggcct ccgccgtcgt tgcgcccgtt       120
     gcgcaggcca gcgacggccg cattccggtg ccggacagat atgcggcgaa attccaggcc       180
     tgcctggacc aggcggcgga ggcgccggac aagggcgtcg ccttcgcgca gcaatggcgg       240
     atcgagggcg gcagcttcta tgcgcgcaac tgcatgggct ttgcctatgc ccgcgccgaa       300
     cgctgggcgc ccgccatcgt cgccttcgaa cagggcgcgg acgaagccga gcgcaacggc       360
     gaaatggcgc agagcgcccg gctgtgggcg caggccggca atgccgcgct ggccggcggc       420
     gatgccgcga aggcgcgcga tgatttcgac gcggcgctgg cgcggggcct gcccgacggc       480
     atggagaagg gcgaggtcca tctggaccgc gcccgggcgc tggtggcgct gaacgacggc       540
     gggagcgcgc gcgcatcgct cgacatcgcg ctggaacagg tgccgcaaga tcccctggcc       600
     tggctgcttt cggccacgct ggcgcgccgg tccggggaaa tgaagctggc gcaggcgcat       660
     atagcgcggg cggtgcagct ttcgcccgat gatgcctccg tcgcgctgga ggagggcaat       720
     atcgccatcc tcaccgatca tgaggacgtc gcccgatccg cctggcaacg cgcggtgaag       780
     ctggcggcgg atgcgcccgc gggcagggcg gcggccgaca atctgtcccg cttgccgccg       840
     aagcccgccg actga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page