(data stored in ACNUC7421 zone)

EMBL: AP010803.PE335

AP010803.PE335       Location/Qualifiers
FT   CDS_pept        349904..350104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03350"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95169"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXT7"
FT                   /protein_id="BAI95169.1"
FT                   /translation="MSLVAIVGPGCSRLEDLIDEIVVGDGSVTDRFLCTTSHPDETYDD
FT                   VLNMVECWEMERDDAIAEVRL"
     gtgtctctgg ttgcgattgt cgggccgggc tgttcgcgat tagaagactt gattgatgaa        60
     atcgttgtgg gcgatgggtc cgtgactgac cgcttccttt gcaccacgtc tcatcctgac       120
     gaaacatatg acgacgtgct caacatggtc gaatgctggg agatggaacg ggacgatgcg       180
     atagctgagg ttcgattgta g                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page