(data stored in ACNUC7421 zone)

EMBL: AP010803.PE336

AP010803.PE336       Location/Qualifiers
FT   CDS_pept        350191..350439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03360"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95170"
FT                   /db_xref="GOA:D4YXT8"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXT8"
FT                   /protein_id="BAI95170.1"
FT                   /translation="MRPPAHRYKFTIMSDAEYEWKPRPPNLRERIIAGVFVAVLLVTLA
FT                   SEYAGWGLFADYEKQVMGLLILIGLILLRFAPSVHRR"
     ttgcggccgc cagcacatcg ctacaaattc acgatcatga gtgacgcaga atacgaatgg        60
     aaaccccgcc ctccaaattt gcgcgagcga atcatcgcag gcgttttcgt agcggttctt       120
     cttgtcaccc tggccagtga gtacgcggga tggggcctgt tcgcagacta cgagaagcag       180
     gtcatgggcc tgctgatact gattggattg atcctgctgc ggttcgcgcc atcggttcac       240
     cgccgttag                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page