(data stored in ACNUC7421 zone)

EMBL: AP010803.PE338

AP010803.PE338       Location/Qualifiers
FT   CDS_pept        350949..351224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03380"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95172"
FT                   /db_xref="GOA:D4YXU0"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXU0"
FT                   /protein_id="BAI95172.1"
FT                   /translation="MVRSLNAAVAMVIAPALLLVAAAHTGLFALGSRPLTYAILVLAWL
FT                   IGMVAIGSAGWSRKITVGLMVIYTIIGIPALPLAGLLAVCSTGDCI"
     atggttcgtt cattaaatgc agcagtcgcc atggttatag cacctgcttt gctgctggtt        60
     gccgctgcgc acaccggctt gttcgcactc ggatcgaggc ctctgacgta tgccatactt       120
     gttctggcat ggctcattgg catggtggct atcgggtcgg cgggatggtc gcgtaaaatt       180
     accgtcgggt tgatggtcat ctatacgatc atcggtattc ctgccttgcc cctcgcgggc       240
     cttcttgcgg tctgttccac aggcgactgc atctaa                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page