(data stored in ACNUC7421 zone)

EMBL: AP010803.PE339

AP010803.PE339       Location/Qualifiers
FT   CDS_pept        351564..352109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03390"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95173"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXU1"
FT                   /protein_id="BAI95173.1"
FT                   /translation="MIETRQQGAQPLVPQELGSGGGGGVVGEAVAVDLGGGRVIFALLS
FT                   GPEGRSIYAMVPRVLNYPDLKPPLSRQFKLHEWQEAYDEAEDVKPFAVLRREDYPMLVS
FT                   FGDLGNPKSVGAVNPDMVGVRRITLQVTDDPVTTGIEKRLGWLGAYPESRLDGVYRGDT
FT                   GMPLARRLSNGDFRMEPI"
     gtgatagaga cgcggcaaca gggggctcag cctctggtcc cgcaagagct tggctctggc        60
     ggtggcggcg gggttgtcgg tgaagcggtg gcggtcgatc ttggcggcgg gcgtgtaata       120
     tttgcactgc taagcggacc cgaagggcgc agcatttatg ccatggtgcc gcgtgtgctc       180
     aattaccctg acctgaaacc gcccctctcg cggcaattca agctgcacga atggcaagag       240
     gcatacgacg aagccgaaga tgtcaaaccg ttcgccgtgc ttcggcgtga ggattatccg       300
     atgctggtga gttttggtga tctgggcaat ccaaagagcg ttggggcggt caaccccgac       360
     atggtcgggg tacgccggat taccctgcaa gtgaccgatg atcctgtcac gacgggaatt       420
     gagaagcggt tggggtggtt gggagcttat cctgaatcca gattggatgg agtctatcga       480
     ggcgataccg gaatgcccct tgcgagaagg ctatctaatg gcgactttag aatggagcct       540
     atctag                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page