(data stored in SCRATCH zone)

EMBL: AP010803.PE34

AP010803.PE34        Location/Qualifiers
FT   CDS_pept        33543..34562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00340"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94868"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWY6"
FT                   /protein_id="BAI94868.1"
FT                   /translation="MNALAPLLAPLWFAQLFTGAKSFVDNPLIGSTRLNALGLHAGRVR
FT                   AAQALAAARRRRLADGVDPEHRGIFDRDGVVEIRDFLPAATFSALQEQLFSYRGPAREM
FT                   VQGDTITRRLAMDPAARRAIPAFEDFRRDPRWQGLARYVSGFDIEPLLYVQSILPRRRD
FT                   AAPDPQLAFHADTFYPAMKAWLFLEDVPVETGPFAYVKGSHRLTPQRLAWEKQRSLGAR
FT                   DGDCRLSARGSLRIDVSELTGLGLPQPSVFAVPANTLLIADTFGFHARSPASAPATRVE
FT                   IWAYGRRNPFRPIKGWDVWSLPGIAERRIPLRWWLGDRAGGWIRQPWLPVGVKGAADG"
     atgaacgccc ttgcgcccct gctcgcgcct ctctggttcg cccagctatt caccggcgcc        60
     aaatccttcg tcgacaatcc gctgatcggt tcgacgcggc tcaacgcgct ggggctgcat       120
     gcggggcggg tgcgggcggc gcaggcgctg gcggcggcgc ggcgcaggcg gctggccgac       180
     ggcgtcgatc cggaacatcg ggggattttc gaccgggacg gtgtcgtcga aatccgggat       240
     ttcctgcccg ccgcgacctt tagcgccttg caggaacagc ttttcagcta tcgcggacct       300
     gcgcgggaga tggttcaggg cgatacgatc acccgccgcc tcgcgatgga ccccgccgcg       360
     cgccgggcga tcccggcctt tgaggatttt cgccgcgatc cccgctggca gggtctggcc       420
     cgctatgtgt cgggtttcga catagagccg ctgctctatg tccagtcgat cctgccgcgc       480
     cgtcgcgatg ccgcgcccga tccccagctc gcattccatg ccgacacctt ttatcccgcg       540
     atgaaggcct ggctgtttct ggaggatgtg cccgtcgaaa ccggaccctt cgcctatgtg       600
     aagggttcgc accgcttgac gccgcagcgg ctggcctggg aaaagcaacg cagcctgggc       660
     gcgcgggacg gcgattgccg cctttcggcg cggggatcgc tgcggatcga cgtcagcgaa       720
     ctgacggggc tgggcctgcc gcaaccgagc gtctttgccg tgcccgccaa tacgctgctg       780
     atcgccgaca cgttcggctt ccatgcccgc agtccggcca gcgcgcccgc caccagggtg       840
     gagatctggg cctatggacg ccgcaacccg ttccggccga tcaagggatg ggatgtctgg       900
     agccttcccg gcatagccga gcggcgcatc ccgttgcgct ggtggctggg cgacagggcg       960
     ggcggctgga tcaggcagcc atggctgccg gtcggcgtca agggtgcggc ggacgggtga      1020
//

If you have problems or comments...

PBIL Back to PBIL home page