(data stored in ACNUC7421 zone)

EMBL: AP010803.PE340

AP010803.PE340       Location/Qualifiers
FT   CDS_pept        352115..352384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03400"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95174"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXU2"
FT                   /protein_id="BAI95174.1"
FT                   /translation="MMIGFLRWQLCSFVQKKLPARKPPSLVIAARNSDGLGPQPTSSVL
FT                   SPAAGLLSKPEPDQRVMATQSDSLAVSDDAWWEGDGPLSSMAWW"
     ttgatgatcg ggttcctacg atggcagctt tgctctttcg tgcaaaaaaa gctgccagcc        60
     cgcaaaccac ccagcctggt catagcagca cgaaattcag atggcctcgg tccacaacca       120
     accagttcgg tcctgtcgcc tgccgctggg ctgctttcca agcccgaacc ggaccagcgg       180
     gttatggcaa cgcagagcga ctcgctggcg gtgagcgacg atgcatggtg ggaaggggac       240
     ggtccgctgt cgagcatggc atggtggtaa                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page