(data stored in SCRATCH zone)

EMBL: AP010803.PE341

AP010803.PE341       Location/Qualifiers
FT   CDS_pept        352414..352572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03410"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95175"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXU3"
FT                   /protein_id="BAI95175.1"
FT                   /translation="MTKPWIIALWVFTVALAGWLLVDGQRFAAAGVMGTALFWEAIHRM
FT                   FGSKGTE"
     atgacgaagc catggattat cgcgctctgg gtcttcacgg tcgcgttggc agggtggctg        60
     cttgtcgatg gtcaacgctt cgctgccgcc ggtgtaatgg gcaccgcgtt attctgggaa       120
     gcgatccatc gtatgttcgg cagcaagggc accgaatag                              159
//

If you have problems or comments...

PBIL Back to PBIL home page