(data stored in SCRATCH zone)

EMBL: AP010803.PE343

AP010803.PE343       Location/Qualifiers
FT   CDS_pept        complement(353608..354192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03430"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95177"
FT                   /db_xref="GOA:D4YXU5"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXU5"
FT                   /protein_id="BAI95177.1"
FT                   /translation="MFSNPHFERVRQMFADQFEPDGDSFLYRKSMKGAPVRVSGTERDE
FT                   FVKSFNRRLRYAMWLIFPATLILIGLLVWLVPDVNSAAGHVATYAGIAVILAPFLASYY
FT                   WAWNAPSRELQRRPAEGVARSREEVRRLMFSKMTYGQLGFVALAGIALVWKALGDTDIF
FT                   HGWGVLWLLFAALLIAAAGAQAIRKWRYERG"
     atgttcagca atcctcattt tgagcgcgtc cgtcagatgt ttgcggatca gttcgagcct        60
     gacggcgaca gctttctcta tcgtaagagc atgaagggcg cgccggtccg cgtcagcggg       120
     actgaacggg atgagttcgt gaagtcgttc aatagacgat tacgctacgc tatgtggttg       180
     atatttccag ccacgctgat cttaatcggc cttctagttt ggctggttcc tgacgttaat       240
     agcgccgctg ggcatgttgc cacctatgct ggaattgccg ttattttggc gccctttttg       300
     gccagttatt attgggcttg gaacgcgcct tcgcgcgagt tgcagcgtcg tccagcggaa       360
     ggagtagcgc gctcgcgcga agaggtccgg cgattgatgt tctccaagat gacatacggt       420
     caactcgggt ttgtggcact ggcggggatc gcccttgtat ggaaagcatt aggcgatact       480
     gatatattcc atggatgggg tgtcctctgg ctcctgtttg cggcgctact gatcgctgcc       540
     gcaggcgccc aagccattcg gaaatggcgt tacgagcgag gttaa                       585
//

If you have problems or comments...

PBIL Back to PBIL home page