(data stored in ACNUC7421 zone)

EMBL: AP010803.PE344

AP010803.PE344       Location/Qualifiers
FT   CDS_pept        complement(354305..354457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03440"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95178"
FT                   /db_xref="GOA:D4YXU6"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXU6"
FT                   /protein_id="BAI95178.1"
FT                   /translation="MATVTDHLFDMGWGWDARIIWTAPIIVAGAVSVRLIGLAICRAVG
FT                   AIPHK"
     ttggcaaccg tcacggatca cctgttcgac atgggatggg gttgggatgc gcggatcatt        60
     tggactgcgc ctatcatagt tgctggagcg gtgagcgtgc gcctcattgg attagcgata       120
     tgccgagcgg tcggagcaat cccgcataaa tga                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page