(data stored in SCRATCH zone)

EMBL: AP010803.PE345

AP010803.PE345       Location/Qualifiers
FT   CDS_pept        354492..354614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03450"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95179"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXU7"
FT                   /protein_id="BAI95179.1"
FT                   /translation="MLTLKLQNEPSILGFVLHLGYWYDRFQSKAMEDWVSATGR"
     gtgctgactt tgaaattgca aaacgagccg tcgatattag gtttcgttct tcatcttggc        60
     tattggtatg accgcttcca gtctaaggca atggaagatt gggtgtctgc aactggtcgt       120
     taa                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page