(data stored in ACNUC7421 zone)

EMBL: AP010803.PE346

AP010803.PE346       Location/Qualifiers
FT   CDS_pept        354804..356846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03460"
FT                   /product="transglutaminase-like protein"
FT                   /note="transglutaminase-like enzyme, putative cysteine
FT                   protease"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03460"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95180"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR024618"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXU8"
FT                   /protein_id="BAI95180.1"
FT                   /translation="MLRSIIGLTVAAIAANTALAADKVQYGKPAAWVLPTPAPTEGIAQ
FT                   VGAAARTIYSDTQTRVGDKGDDIYTAWRIRLLTADALSIGNIAASWNPASGSATVHHLR
FT                   IWRDGKPIDVLKKARFAVVRQEVNLEASMLTGILTASLQTPGLQVGDELEFAATIHGQD
FT                   PTLGDHHFGLSALPPQGNPGAYRMRLSWPAGQTLRWQGTADMGELTPKAEDNYKAVDYT
FT                   LRDPKSATPTDGAPARYNVRRLLEYSDFTDWADVSRRMWGLFDEASALKPGSPLRQEIA
FT                   KIAAADKNPAARAEAALALVQNHIRYVYVGLNGGNYRPATIDESWTRRFGDCKAKTALL
FT                   LAILRELDVPAEAVLVQTAGGDGLDQRLPSPVLFDHVLVRATIGDKPYWLDGTRLGDQH
FT                   LALIPPPSFRWVLPLRKEGGTLEAVAPTAPKEPQLIGFEEVDMREGIAKPARVTLRNIL
FT                   RGDEIYAMRTMLASLSPEEADRQLQSYWQQQADWVDADKVEWRYAENQAALILTLTGRG
FT                   KLEWKGSDQDGWYSYMHGAGLYAPNKRKRPKEQDQSAPFAIEFPRFRCWATVLRLPKPN
FT                   GNWHWNVAGKRMNRTLGGVAYWRGISINDNVVRSVQSTRSLTPEISAEDVRTANDLIPG
FT                   FDNDMTRVEQDFTLKADVGRSEPMLDKGDQIDWAASNTPCQGPGK"
     ttgctgcgga gtatcattgg tctgaccgtt gcggctattg cagcaaatac ggcgctcgcc        60
     gccgacaaag ttcaatatgg caagcctgct gcttgggtgc tgccaacgcc tgcaccgact       120
     gaagggattg cgcaggtggg ggcggctgcg cgtaccattt attctgatac gcagacacgc       180
     gtaggcgaca aaggcgacga tatttatact gcatggcgca tcaggctgct caccgccgac       240
     gccttgtcca taggcaatat cgccgcgagc tggaatcctg caagcggctc cgcaaccgtc       300
     catcacctgc gtatctggcg cgacggcaaa ccgatcgatg tactaaaaaa agcgcgcttc       360
     gctgtcgtac ggcaagaggt caaccttgaa gcctccatgc tgaccggaat cctgacggca       420
     agtttgcaaa cgcccggact tcaggtcggc gacgaactgg agtttgcggc caccatccac       480
     ggacaggatc cgaccttggg cgaccatcat tttggcctca gcgcgttgcc gccacaagga       540
     aacccaggcg cttatcgtat gcgactgagt tggcctgcgg gccaaacgct gcgttggcag       600
     ggaacagccg acatgggtga actcacacca aaggctgagg ataattataa ggcggtcgac       660
     tatacactgc gtgatcccaa gtccgccacg ccgaccgatg gcgcaccagc gcgctataat       720
     gtgcgccggt tgctggaata ttcggatttt accgattggg cagatgtttc caggcgcatg       780
     tgggggcttt tcgacgaagc gtcggcattg aagccgggat cgccgctcag gcaggaaatc       840
     gcaaagattg ccgcagcgga taagaacccg gcggcgcgag ccgaagccgc tttagcgctg       900
     gtgcagaacc atatccgcta cgtgtatgtg gggctgaacg gcggaaatta tcgccctgcc       960
     actatcgacg aaagctggac gcgccggttt ggtgactgca aggccaaaac cgcattgttg      1020
     cttgccatcc tgcgtgaact ggacgttcca gcagaggcgg tgctggtcca gaccgcgggt      1080
     ggcgatgggc tggaccagcg attgccaagt cccgtgctgt tcgaccatgt cctggtccgc      1140
     gcaaccatag gggacaagcc ttattggttg gacggcacca ggcttggcga tcagcatctt      1200
     gcactaatcc caccgccgtc ctttcgctgg gtgctcccgc tgcgcaagga aggcggcacg      1260
     ctggaggccg tggcgcccac cgcaccaaag gaaccacaac tgatcggctt cgaggaagtc      1320
     gatatgcgcg aaggcatagc aaagcccgcc agggtgacgc ttcgcaatat tctgcgcggc      1380
     gacgaaatct atgccatgcg cacaatgttg gccagtctgt cacctgagga agcggaccgc      1440
     cagttgcaga gctattggca acagcaggct gactgggtcg atgcggataa ggtggagtgg      1500
     cgttatgccg aaaaccaagc cgcgttgatc ctcaccctga ccggacgggg aaagctcgaa      1560
     tggaagggca gcgatcaaga tggctggtac agctacatgc acggtgcggg gctttacgcc      1620
     cccaacaagc gaaaacgtcc caaggaacag gatcagtcag cgccctttgc cattgaattt      1680
     ccccggttcc gttgctgggc gacggtgttg cgcctgccta agcccaacgg caactggcac      1740
     tggaacgtag cgggcaagcg catgaaccgt accctcggtg gcgtagccta ttggcggggc      1800
     atttcgatca atgacaatgt cgtgcgatca gttcaatcca cccgcagcct gaccccagaa      1860
     atcagcgcgg aggatgtcag gaccgcaaat gatctcattc ctggctttga caacgatatg      1920
     acacgagtgg aacaggattt caccttgaag gctgatgtcg gccggagcga acccatgctc      1980
     gacaagggcg atcagattga ctgggccgct tccaacacac cgtgccaggg gccgggcaaa      2040
     tga                                                                    2043
//

If you have problems or comments...

PBIL Back to PBIL home page