(data stored in ACNUC7421 zone)

EMBL: AP010803.PE347

AP010803.PE347       Location/Qualifiers
FT   CDS_pept        complement(356878..357504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tonB"
FT                   /locus_tag="SJA_C1-03470"
FT                   /product="TonB-like protein"
FT                   /note="periplasmic protein TonB, links inner and outer
FT                   membranes"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03470"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95181"
FT                   /db_xref="GOA:D4YXU9"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXU9"
FT                   /protein_id="BAI95181.1"
FT                   /translation="MLLHDRRMKNARISLSVLSLISVAAVPAPAEPKHRATPLTSPGTW
FT                   FTDADYPMDAARAEIEGTTVFRLEINSAGVPQRCIITTSSGSASLDNATCDKLMVRARF
FT                   TIPKDARGRSVSDIYNGRITWRLPDTNAPARLPSIPHMMKVTFYVNPDGTTSDCIATLN
FT                   DVEPGPPEICATQVLNRHFPVQNDASGKPVRQKLRMVMGIEKVAD"
     atgttgttgc acgacaggcg gatgaaaaac gctcgcattt ccttatcggt tctgtcgctt        60
     atatcggtcg ccgccgtgcc cgcccctgcc gagcccaaac atagggcgac cccactaacg       120
     agtccgggca catggttcac agatgccgat tatcccatgg atgccgcgcg cgccgaaatc       180
     gaaggcacca ccgtattccg gctggagatc aacagcgcag gagtgccaca gcgctgcatc       240
     atcaccacaa gtagcgggtc cgccagtctc gacaacgcga cctgtgacaa gctcatggtt       300
     cgtgcccgct ttacaatccc gaaagatgcc agaggcaggt ccgtttcgga tatatataat       360
     ggtaggataa cctggcgcct acccgataca aacgcacccg cgcgacttcc gtctattcct       420
     cacatgatga aggtgacttt ctatgtgaat cccgatggaa cgacatctga ttgtatcgcg       480
     acattaaacg atgtggagcc tggtcctcct gaaatatgcg ccacccaggt gttgaaccgg       540
     catttccccg tacaaaatga tgcgtcgggt aaacccgtgc ggcagaagtt gcgaatggtg       600
     atgggcatcg aaaaggttgc ggattaa                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page