(data stored in ACNUC7421 zone)

EMBL: AP010803.PE348

AP010803.PE348       Location/Qualifiers
FT   CDS_pept        complement(357644..357871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03480"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95182"
FT                   /db_xref="GOA:D4YXV0"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXV0"
FT                   /protein_id="BAI95182.1"
FT                   /translation="MSREHRPLKDTDLPQQDRIEPITVRIPDACRMLGIRRSKLYELIA
FT                   EGEIRTLKLGSATLVPVEGIRKLVARLKEG"
     atgagccgtg agcatcgacc gctgaaggat accgatctgc cgcagcagga ccggatcgaa        60
     ccgatcaccg tgcgcattcc cgacgcatgc cgcatgctcg ggatcaggcg cagcaaactc       120
     tatgagctca tcgcagaggg cgagatcagg acgctcaagc tgggaagtgc cacgctcgtg       180
     ccggtagagg ggatcaggaa actggtggcc cggctcaagg aaggttga                    228
//

If you have problems or comments...

PBIL Back to PBIL home page