(data stored in ACNUC7421 zone)

EMBL: AP010803.PE349

AP010803.PE349       Location/Qualifiers
FT   CDS_pept        complement(357868..358287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03490"
FT                   /product="hypothetical protein"
FT                   /note="CopG-like DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03490"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95183"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXV1"
FT                   /protein_id="BAI95183.1"
FT                   /translation="MKSTKTRHQLFLPEEMSRRLEHLAASSGRARSEILVEALDAWFNR
FT                   RQAPKSDEALGIRLTRIERNTDWLRRNQALVWEVLARMVRHQLTTGAMTPVNAAAQAAG
FT                   AKMFAELINEIADRFAGKAAPATDDPITRKLRSLQ"
     atgaagagca ccaagacccg gcatcaactg ttcctgcccg aggagatgag caggcggctt        60
     gagcatctcg cggcaagttc ggggcgggcg cggtctgaga tattggtcga ggcgctcgat       120
     gcttggttca accggcggca ggcgccgaag tccgacgagg ccctcggcat ccgcctcacc       180
     aggatcgagc gcaacaccga ctggctgcgg cgcaaccagg cgctggtctg ggaagtgctg       240
     gcccgcatgg tccggcatca gctcaccacc ggggccatga ccccggttaa cgccgccgcg       300
     caggccgcag gggcaaagat gttcgccgag ctgatcaacg agattgccga ccggttcgcg       360
     ggcaaggcag cgccagccac tgacgatccc atcacccgaa agctgaggag tttgcaatga       420
//

If you have problems or comments...

PBIL Back to PBIL home page