(data stored in ACNUC7421 zone)

EMBL: AP010803.PE351

AP010803.PE351       Location/Qualifiers
FT   CDS_pept        360777..361139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03510"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95185"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXV3"
FT                   /protein_id="BAI95185.1"
FT                   /translation="MGVQIEAMDGGKLKLTGDVETVLTLPASAVTDGFSFAFSDGTLLR
FT                   GHHDIGSGRCHFELGAQGAASVRIMREGRHDSARIDGQIEWMTLACGSRTLCPIHAKPH
FT                   DDGRQLVLDMDARQAA"
     atgggcgtgc agatcgaggc aatggatggc gggaagctca agctgaccgg cgatgtcgag        60
     accgttctca ccctgcccgc cagcgccgtg acggatggct tttccttcgc cttttccgac       120
     ggaacattgc tcaggggcca tcatgatatt ggcagcggcc gctgccattt tgaattaggc       180
     gcgcaaggtg cggcgagcgt caggatcatg cgcgaagggc ggcatgacag tgcgcggatc       240
     gacggacaaa tcgaatggat gacgcttgcc tgcggcagca ggacgctctg cccgatccat       300
     gcgaagccgc acgatgacgg acggcagttg gtgctggata tggacgccag gcaagcagcc       360
     tga                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page