(data stored in ACNUC7421 zone)

EMBL: AP010803.PE353

AP010803.PE353       Location/Qualifiers
FT   CDS_pept        complement(362134..362391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03530"
FT                   /product="ECF-type sigma factor"
FT                   /note="DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma24 homolog"
FT                   /note="remnant"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03530"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95187"
FT                   /db_xref="GOA:D4YXV5"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXV5"
FT                   /protein_id="BAI95187.1"
FT                   /translation="MTDTPDLERLERLEAALLTMPRLRREIFLAVRLDAMRYEDVARIT
FT                   GLSVRAVERQMARAIAHIGYHLRHGAAQPPRRWWYRRRGK"
     atgaccgaca cccccgatct tgaacggctg gagcgtctgg aggcagcttt gttgacgatg        60
     ccgcgcctgc gccgcgagat attcctcgcc gtccggctcg atgccatgcg ctatgaggat       120
     gttgccagaa ttaccggcct ttccgtcagg gccgtcgagc ggcagatggc ccgcgccatc       180
     gcccatatcg gctatcatct gcgccatggc gcagcgcagc cgccgcgacg atggtggtac       240
     agacggcgag gcaaatga                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page