(data stored in ACNUC7421 zone)

EMBL: AP010803.PE354

AP010803.PE354       Location/Qualifiers
FT   CDS_pept        complement(362449..364209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03540"
FT                   /product="ParB-like protein"
FT                   /note="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03540"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95188"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXV6"
FT                   /protein_id="BAI95188.1"
FT                   /translation="MELKHIDIAKLSVAAVNMRGKGKADLSNILPSVRARGVLVPLIVR
FT                   ANGSPDSYEIVAGKRRYQAALAVMQESGEAEALPCAVIEAGDDAAALEASLIENIARLD
FT                   PDEMTQCETFTRLMREGRTMEELSLTFGLTALQVKRTLALGNLLPRIRNLYRAAKIDVV
FT                   TVRHLTLASKSQQRDWLALLDDESAYVPTGSALKAWLFGGVSIPVKAALFDVDSYEGGI
FT                   VADLFGEDRYFADVSAFWTAQQAAIEERVEQYRNAGWRDVVLLSQGEPFHGWEYERCPK
FT                   RKGGKVYVVTSHRGDVAFHEGYLTSKEARKLERQGESGEASDKPSRPEVTSSQQDYIDL
FT                   HRHAAVRAAMIGHPGLCLRVAVAHMIAGSPLWTIRAEPQRAADAIAESVENSASEARFD
FT                   AERRRLLALLDFDADTPTITGGSDGLTSLYARLCTLDDATVMSILSVVMGETLDARCDL
FT                   VDALGMQLGIDMAQVWQADDTLFDGLRDREVIDAMLAEVAGKDIAEANAKETGKTKKQI
FT                   IRDCLKGSNGRAKVEGWVPRWLRFPASGYTNRGGVASVSRTASAMEAMALSSDTTDEPQ
FT                   VDPAPMSQAA"
     atggaactca agcatatcga catcgcaaag ttgtctgtcg ctgccgtcaa catgcgcggc        60
     aagggcaagg cggacctgtc caatatcctg ccgtccgtca gggcgcgggg cgtgctggtg       120
     ccgctgatcg tgcgggcgaa tggcagtccg gacagctatg agatcgtggc aggcaagcgg       180
     cgctatcaag cggccttggc cgtgatgcag gaaagcggcg aagccgaggc gctgccctgt       240
     gcggtgatcg aagcagggga tgacgcggcg gcgctggaag cctcgctgat cgagaatatc       300
     gcccggctcg atcccgacga gatgacccag tgcgagacct tcacgcggtt gatgcgcgag       360
     ggacggacca tggaagagct atcgctgacc ttcgggctca ccgcgttgca ggtcaaacga       420
     acgctggccc tgggcaatct cctgccccgc atccgcaatc tctaccgggc cgcgaagatc       480
     gatgtcgtga ccgtgcggca tctgaccctc gcttccaaat cccaacagcg cgactggctg       540
     gccctgctcg atgacgagag cgcctatgtg ccgacgggat cggctttgaa ggcgtggctg       600
     ttcggcgggg tatcgatccc ggtcaaggcg gccctgttcg atgtggacag ctatgagggg       660
     gggatcgtgg ccgacctgtt cggggaggat cgctactttg ccgatgtctc ggccttctgg       720
     accgcacaac aggcagcgat agaggaacgg gtcgagcaat atcgcaatgc aggatggcgc       780
     gatgtcgtgc tgctgtcgca gggcgaaccc ttccatggct gggaatatga gcgttgtccc       840
     aagcgcaagg gcggcaaggt ctatgtcgtc accagccatc gcggcgatgt cgccttccat       900
     gagggttatc tcacatcgaa ggaagcccgc aagctggaga ggcaggggga gagcggtgag       960
     gccagcgaca aaccttcccg gcccgaagtg acgagcagcc agcaggatta tatcgacctg      1020
     caccgccatg ccgccgtccg ggcagcaatg atcggccacc ccggcctgtg cctgcgggtg      1080
     gcggtggcgc acatgatcgc gggatcgccg ctctggacga tcagagccga gccgcagcgc      1140
     gctgccgatg cgattgccga gagcgtcgag aacagcgcat ccgaagcacg gttcgatgcc      1200
     gaacggcgca ggctgttggc gttgctcgac ttcgatgccg ataccccgac catcacgggt      1260
     ggcagcgatg ggctgaccag cctctacgcc agactctgca cgctggacga tgctaccgtc      1320
     atgtccatcc tgtcggtggt gatgggcgag acattggatg cccggtgtga tcttgtcgat      1380
     gcgctgggca tgcagcttgg tatcgacatg gcgcaggtct ggcaggctga cgacaccctg      1440
     ttcgacggtc tgcgcgaccg cgaggtcatt gacgccatgc tggccgaggt ggcgggcaag      1500
     gacattgccg aagccaacgc caaggagacc ggcaagacca agaagcagat catccgcgat      1560
     tgcctcaaag gcagcaacgg acgcgccaag gtcgagggct gggtgccgcg ctggctgcgc      1620
     ttcccggcga gcggttacac caatcggggt ggcgttgcca gcgtcagccg caccgccagc      1680
     gccatggaag ccatggcctt gtcgtccgac acgacggacg aaccgcaggt cgatcccgcg      1740
     cccatgtcgc aggctgcatg a                                                1761
//

If you have problems or comments...

PBIL Back to PBIL home page