(data stored in SCRATCH zone)

EMBL: AP010803.PE357

AP010803.PE357       Location/Qualifiers
FT   CDS_pept        364957..367017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03570"
FT                   /product="putative signal transduction protein"
FT                   /note="putative signal transduction protein containing a
FT                   membrane domain, an EAL and a GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03570"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95191"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXV9"
FT                   /protein_id="BAI95191.1"
FT                   /translation="MEKVSDKVIARAARALRGDPSLPNSHDLQAVLVRCWTRALGHFCR
FT                   SYDTKTGAFAERLYLNDIVKLCDDLAKAGLQADLGDFDQARLRIALSDPSMRLDRTNTI
FT                   DLIAFLETHLGSMPDGIRSALLDGIPPDCPGWSSCFSLFVTEEMKSSPKVFQIFVTERL
FT                   ATIEALAEASAQTTDRIETSLGDLARTSTETGHDIRWIVDRLKQLPSLDDTDLTEIAAF
FT                   FGIFDADGAAAARKAIMVKARELGVLKDRVVEYEAAERELTRIAFVDHLTGAPNRSHFY
FT                   RELGDRSRRTDNAAFVRHLAFLDIDGFHQINNAWGHDAGDHVLSEIARRLQDLALASEA
FT                   IFCRYGGDEFLLGFEAQEVETERLQNLAEAARKAVSAPISYLAQTLRVTASVGLSADDA
FT                   DVVIERSIKSADLALYRAKESGRDRAVLFEQRFHEDVEERRALEVALRTAIENEELRLR
FT                   YAPVVDLATENIVGFEALVRWHNPDRGWISPVTFVPVAEECGLIRLIGDWVLRTACADA
FT                   TQWLRPIPVAVNISPLQWDESLIGNLQSVLAETRLSPERLELEVTESIFLIDTAECFAL
FT                   AKQIDALGIGLVLDDFGTGFSSLSCLGRTPFKSIKIDQSFIRSAVGGDAGSSAIIHGTV
FT                   TMARALEIEITAEGIETEADLLLAKELGCTRAQGFYFAKPMDAEAVRQAIS"
     gtggagaaag tcagcgacaa ggtaattgcc agggctgccc gcgcactacg tggcgatccc        60
     agcctgccga attcgcacga tcttcaggcc gttctggtgc gctgctggac gcgtgccctc       120
     gggcatttct gccggtccta tgataccaaa accggggctt tcgcagagcg cctttatctg       180
     aacgatattg tgaagttgtg tgacgacctc gccaaggccg gcctccaggc cgacctcggc       240
     gatttcgatc aggcccgatt gcgaattgcg ctctcggacc cttcgatgcg gttggatcgc       300
     accaacacga tcgacctgat tgcatttctg gaaactcacc tcggatctat gcctgacggc       360
     atacggtccg cgctgctgga cggcatacca cccgattgtc ccggatggag ttcctgcttc       420
     tcgctgttcg tcaccgagga gatgaaatcc tctccgaagg ttttccagat cttcgtgacg       480
     gagcggttgg cgaccatcga ggcgttagcc gaggccagcg cacagacgac cgaccgaatc       540
     gagacgagcc tgggagactt ggcgcggacc tcaaccgaga caggtcatga catccgttgg       600
     atcgtcgacc ggctcaagca gcttccgtcc cttgacgaca ccgacttgac cgagatcgca       660
     gccttctttg gaatcttcga tgcggacggc gctgctgcgg cccgcaaggc aatcatggtc       720
     aaggcgcgcg agctaggcgt gctcaaggat cgtgtggtcg agtacgaagc cgccgaacgc       780
     gaattgacca ggatcgcctt cgtcgaccat ctcacgggcg cgccgaaccg atcgcatttc       840
     taccgagagc tcggcgatcg ttcgcgtcgc accgataacg cagcatttgt taggcatctc       900
     gcattcctcg atatcgacgg ctttcaccag atcaacaatg catgggggca cgacgcgggt       960
     gaccatgttc tgagcgaaat tgctcgtcgc cttcaggatc tggcgctcgc aagcgaggcc      1020
     attttttgcc gatatggtgg cgacgaattt cttttggggt tcgaagcgca agaggtggag      1080
     acggaacggc tccagaacct tgctgaggca gcccgaaagg cagtcagtgc ccctatatcc      1140
     tatttggcgc aaaccttgcg ggtaaccgcc agtgtcggcc tgtcggcaga tgatgccgat      1200
     gtcgtaatcg agaggagcat caaatcggcg gatttggcgc tatatcgggc gaaggagagc      1260
     ggacgcgacc gcgcggtgct gttcgagcag cgtttccacg aggatgtgga agaacggcgt      1320
     gcgctggagg ttgcgctccg cacagcgatt gaaaatgagg aactacgcct gcgttacgcg      1380
     ccggtggtcg atctcgcgac agaaaatata gtcgggttcg aagcgctcgt ccgctggcac      1440
     aatcccgatc gcgggtggat atcgcccgtg actttcgtac ccgttgccga ggaatgcgga      1500
     ctgatacgtc tgatcggcga ttgggtgttg cggaccgctt gcgctgacgc cacacaatgg      1560
     ctgcgaccca ttccggtcgc ggtgaatatt tctcctctcc aatgggacga aagtctgatc      1620
     ggcaatttgc aatccgtatt ggccgaaaca cggctgtcgc ccgagcggct tgagcttgag      1680
     gtgacggaat ctattttcct aatagacact gcggaatgct tcgcgcttgc gaagcagatt      1740
     gatgctcttg ggatcggttt agtgctggac gatttcggga caggattttc gtcgctcagc      1800
     tgcctgggtc gtacgccctt taagtcgatc aagatcgacc agagcttcat ccgatccgca      1860
     gtcggcggag atgccgggtc atccgccatc atccatggta ccgtcacgat ggcacgtgcg      1920
     ctggaaatag agataacggc agaggggatt gagacagagg ccgacctttt gcttgccaag      1980
     gaactaggct gcacgcgtgc gcaaggcttt tattttgcga aaccaatgga tgctgaagct      2040
     gtgcgacaag cgatttctta g                                                2061
//

If you have problems or comments...

PBIL Back to PBIL home page