(data stored in ACNUC7421 zone)

EMBL: AP010803.PE358

AP010803.PE358       Location/Qualifiers
FT   CDS_pept        367359..367583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03580"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95192"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXW0"
FT                   /protein_id="BAI95192.1"
FT                   /translation="MDEVKSRHPQNKLIVRIPTDLPYTAVSSRFILIVCTYYPVVAGST
FT                   VKERDRNWLTCGSLPSCRAIALSTVMVLR"
     gtggacgagg tcaaatcccg gcatccacaa aataaactga tagttcgaat cccgaccgac        60
     ctgccataca ccgccgtcag cagccgtttc atactcatag tctgcaccta ctaccccgtc       120
     gtagcaggtt cgacggtgaa agagcgggat cggaattggc tgacttgtgg cagcttgccg       180
     agttgtcgcg ctatcgcctt gtcaaccgtg atggtccttc gatga                       225
//

If you have problems or comments...

PBIL Back to PBIL home page