(data stored in ACNUC7421 zone)

EMBL: AP010803.PE359

AP010803.PE359       Location/Qualifiers
FT   CDS_pept        complement(367549..368955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03590"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95193"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXW1"
FT                   /protein_id="BAI95193.1"
FT                   /translation="MQFDQPLPEQLKNNPLRLGQSNLKAGLHGHLVELLAREVILNGQS
FT                   RGGKPLNTADAAFKAMGMIHRLDDKSWGLHGSRSDDIILQLSRIAFQQFPWQSPLTNGV
FT                   LARYHMLYAHPLVGPMVEAEFGMSTGELFQLILLFAEEMLQRPTLAFEFLPAAEQSIRA
FT                   PVLALSDRISRSSDDLRTATVERQSYDVNWAYSFNPLRAFPLVHAGNPRSLMCPAPPIL
FT                   LQRLTDGLYFDLIRADRRFGSAIGKAFEHYVGKVVERIGVDVFNLREETCWGKPERRSV
FT                   DWIVSDNSASLFVECKLGRLDIASQTEISPEPPFVAAIGRLAGNVGQLYATLSEALAGG
FT                   YPHWKPDGRPVHPIVVTFHEWFCFGPFFYKHLDELVDTEFEKRGLDRALLKRHPYCVCS
FT                   IAEFEGLLTAGRGANIDIVVSEKMSAAHRQSLMRGFLADRYPGSLSNAMGTFEDGMDLV
FT                   IEGPSRLTRR"
     ttgcagttcg accagccgtt accagagcag ttgaagaaca atccgctcag actgggccaa        60
     tcgaatctga aagctggcct ccatggccat ctcgtggaat tgcttgcgcg agaagtgatc       120
     ctcaatgggc aatcacgcgg tgggaaaccc ctgaacacag cagatgcggc gttcaaggcc       180
     atgggcatga tccatcggct cgatgacaaa tcatggggcc tgcacggctc ccgctccgac       240
     gacataatcc tccaactgtc gcggatagcg ttccagcaat ttccttggca gtcgccgctg       300
     accaacggcg tgctcgcacg ctatcacatg ctctacgctc acccgttggt cgggccgatg       360
     gtagaggcag agttcgggat gtcgactggc gaacttttcc agctcatcct tttattcgcc       420
     gaagagatgc ttcaacgtcc gacactcgcg ttcgagttcc tgcccgctgc cgagcagtcg       480
     atacgcgcgc ccgtattggc gctctcggac aggatttctc gctcatccga tgatttgcgg       540
     acagcgacag ttgagcgcca aagctatgat gtgaactggg cctacagctt caatcccctt       600
     cgcgctttcc cgttggtaca tgccggcaat cctcgctccc tgatgtgccc ggctccgccg       660
     atcctgctcc aaaggctgac cgatggtctc tattttgatc tcatccgcgc ggatcgccgt       720
     ttcggaagcg ccatcggcaa agcctttgag cactatgtcg gcaaggtggt ggagcggatc       780
     ggggttgatg tattcaacct gcgcgaagag acatgctggg ggaaaccgga acgccgcagc       840
     gtggactgga tcgtcagcga caacagcgcc tcgctgtttg tcgagtgcaa gctgggccgt       900
     ctcgacatcg cttcgcagac cgaaatctcg cccgagccgc cgttcgttgc cgcgatcggc       960
     cgcctggctg gaaatgtggg gcagctttac gccacgctta gcgaagccct cgcgggcgga      1020
     tatccccact ggaagcctga tggtcgcccc gttcatccga ttgtcgtcac gttccacgag      1080
     tggttttgct tcggcccgtt tttctacaag catctcgacg aattggtgga cacggagttc      1140
     gagaagcgcg ggttggatcg ggcgttgctc aaacgccatc cttactgtgt ttgttcgatc      1200
     gccgagtttg aggggttgct gacggccggt cgcggagcaa acatcgacat cgtggtttcg      1260
     gagaagatgt cagcagctca ccggcaatcg ctgatgcgtg gatttcttgc tgatcgctat      1320
     ccaggcagcc tgagcaacgc catgggtacg ttcgaggacg gcatggacct cgtcatcgaa      1380
     ggaccatcac ggttgacaag gcgatag                                          1407
//

If you have problems or comments...

PBIL Back to PBIL home page