(data stored in ACNUC7421 zone)

EMBL: AP010803.PE361

AP010803.PE361       Location/Qualifiers
FT   CDS_pept        complement(372654..373436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03610"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95195"
FT                   /db_xref="InterPro:IPR014976"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXW3"
FT                   /protein_id="BAI95195.1"
FT                   /translation="MGLYERWCESTKAKDKRKRYWTYVEKDGGRDEIRDGLAETIRSHY
FT                   DRLERIAEDVDRLGYKVAAEILSEAMPQTAKGRSGDLGEILATELVEEEIGLRVPVRRL
FT                   RYKDGRNMAMRGDDFIGAGYDVAGEKLWLLKGEAKSNKVLGKATVTSARKVLNRDNGRC
FT                   TPDSLLFVANRLLESNDPGDNELGRSLRDEVGLKSLRADRIDHMLFTVSGNGPHASLKE
FT                   DLDATGTNRDHYVVNIHVEDHQDFIAAMYQEAEDLGDD"
     atggggctgt acgagcggtg gtgcgagtcc accaaagcaa aggacaagcg caagcgctac        60
     tggacctatg tcgagaagga cggcggccgc gacgagattc gtgacggcct ggccgagact       120
     atccgctcgc actacgaccg gctcgaacgc atcgccgagg atgtggatcg gcttggctac       180
     aaggtggctg cggagattct cagtgaggcg atgccgcaaa ccgccaaagg ccggtccggc       240
     gatctcggcg agattcttgc cacggagctg gtcgaggaag agattggcct gcgagttccc       300
     gtgcgccgcc tccgctacaa ggacggccgc aacatggcca tgcgaggcga cgacttcatt       360
     ggtgccggat acgatgtggc cggtgaaaag ctctggctcc tgaaaggcga agccaagagc       420
     aacaaggtgc tgggcaaggc cacggtcacg agcgcccgca aggtgctcaa tcgcgacaac       480
     ggccgctgca cgcccgactc cctgttgttc gtggccaacc gtctgctgga gagcaacgat       540
     ccgggcgaca acgagcttgg ccgcagcctc cgtgacgagg tgggcctgaa gtcccttcgc       600
     gccgatcgca tcgaccatat gcttttcacg gtgtcgggca acggcccaca tgcgtcgctg       660
     aaggaggacc tcgacgccac tgggaccaac cgggaccact acgtcgtgaa catccacgtc       720
     gaagatcacc aggacttcat cgcggccatg taccaggagg cggaagacct tggagacgat       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page