(data stored in ACNUC7421 zone)

EMBL: AP010803.PE362

AP010803.PE362       Location/Qualifiers
FT   CDS_pept        complement(373452..373997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03620"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95196"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXW4"
FT                   /protein_id="BAI95196.1"
FT                   /translation="MTPPVYSQLFSCLYDQAEAVGQLGRGTHHSVFRSIQWRDIDGDFR
FT                   DSGRFHHFAVIWDEDHDARIIPMIEHLHMTGLLWPVVFIGERKGMLTVLLSHGIDPTKE
FT                   RSDWFDTVRDIAGHAIENDPWTVEFGTFHRDPANRDQLTEPAGLISDREELVVAYLQAI
FT                   DVLWQLGEERSERQQNQG"
     atgacgccac ccgtatattc gcaactcttc tcgtgcctgt acgatcaggc ggaggctgtt        60
     ggccaacttg gtcgcggcac gcaccactcg gtttttcgca gcatccagtg gcgcgacatc       120
     gacggcgact ttcgggacag cggtcgattt caccactttg ccgtcatctg ggatgaggat       180
     cacgacgctc gaataatccc aatgatcgag cacttgcaca tgacgggtct gctttggccg       240
     gtggtattca tcggcgagcg caagggcatg ctgaccgtgc tgctgtccca cggcattgat       300
     ccgacgaaag agcggtcaga ctggtttgat acggtgcgcg acatcgccgg tcacgccatc       360
     gaaaacgatc cctggaccgt cgagttcggc acattccatc gagatccggc gaaccgggat       420
     cagttgaccg agcccgccgg cctaatcagc gatcgggagg aactggtggt tgcatacctc       480
     caggctatcg acgtgctgtg gcagctcggc gaggagcgga gcgagcgcca acaaaatcag       540
     gggtga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page