(data stored in ACNUC7421 zone)

EMBL: AP010803.PE363

AP010803.PE363       Location/Qualifiers
FT   CDS_pept        374442..374681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03630"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95197"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXW5"
FT                   /protein_id="BAI95197.1"
FT                   /translation="MTYIDRLIANGTNFRVDRKESSASFRPAGDSEADVDAFQSVVRDL
FT                   RANEGDGYKIHLAHPMSDRGHGLIDLVLVTLTQD"
     ttgacataca ttgaccgcct gatcgcgaac ggaacgaatt ttcgtgtcga tcgcaaggag        60
     tcctcggcga gctttcgacc ggccggggac agcgaggccg atgtcgatgc cttccagtcg       120
     gtcgtgcgcg atctgcgcgc gaatgagggc gacggctata agatccatct ggcgcatccg       180
     atgagcgatc gcggtcacgg ccttatcgat ctggttttgg tgacgctcac gcaagactga       240
//

If you have problems or comments...

PBIL Back to PBIL home page