(data stored in ACNUC7421 zone)

EMBL: AP010803.PE364

AP010803.PE364       Location/Qualifiers
FT   CDS_pept        374681..375793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03640"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95198"
FT                   /db_xref="InterPro:IPR025332"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXW6"
FT                   /protein_id="BAI95198.1"
FT                   /translation="MAAHKSHHYVPQFYMRLFSGTAAERVGVFIIAKERFIPKAPIKGQ
FT                   ACKDYFYGTDGHAEETFGAIENATAPILKSIVGGALPAPGSPDYHALMLYLAVQHSRTL
FT                   EAEAQLAEGSEHTMRAMLRTKFELEGNEEMLDWLELVRIKRNNAIGEAVMTGTIGAMLL
FT                   TDLALLLVQNDSDLPFIASDAPVVVHNRLFEATRSVGTAGYANLGLQIFLPLGPRLLLQ
FT                   CYDPAAYAAVDAAAGVVRFDDRATARLLNDLQWEAAGKVILTSPTMDQAELHSAATRWR
FT                   LQRGGPRMIHRQEIVSRTDTEVRVRQGVGPKPSDIALDLPFLAQTMPFPPPLGPYEVAP
FT                   SRDLDRDAMVREAWEDMMDLADRMHPPPPR"
     atggccgccc acaagagtca ccactatgtg ccgcaattct atatgcggct gttctccggt        60
     accgcggccg aacgcgtggg cgtgttcatc atcgccaagg agcgattcat ccccaaagcg       120
     ccgatcaagg ggcaagcctg caaggattat ttctacggaa ccgacgggca cgccgaggag       180
     accttcggcg cgatcgagaa tgccacggct cccattctca aatctatcgt cggcggtgcg       240
     ctcccagcgc cagggagccc cgactatcac gccctgatgc tctaccttgc cgtgcagcat       300
     tcccgcacgc ttgaggccga ggcccagctc gcggagggct ctgagcacac catgcgggcg       360
     atgttgcgca cgaagtttga gctggaaggg aatgaggaga tgctcgactg gctcgaactc       420
     gtccgcatca agcgcaacaa tgcgattggc gaagcagtca tgacgggcac gatcggcgcg       480
     atgcttttga ccgatctggc gcttctgctg gtccagaatg acagcgattt gccctttatc       540
     gcctcggatg cacccgtggt agttcacaac cggctatttg aggcgacgcg ttcggtcggg       600
     accgccggct atgccaattt gggccttcag atcttcctcc cgctcggacc ccgtcttctt       660
     ctccagtgct atgatccagc ggcctacgct gcggtcgatg ctgcggccgg tgtcgttcgg       720
     ttcgacgatc gcgcgaccgc gcgtctcctg aacgatcttc agtgggaggc agcaggaaag       780
     gtgatactga ccagcccaac catggaccaa gccgaactcc acagcgctgc cacgcgctgg       840
     cgattgcaac ggggcggtcc gcggatgatt caccgtcagg agatcgtatc gcggactgac       900
     acggaagttc gcgtgcgcca gggcgtcggc cccaagccct cggacattgc cctcgatctg       960
     cccttccttg ctcagaccat gccgtttcct ccgccgctcg gcccgtatga ggtcgcgccg      1020
     tcgcgtgact tggatcgcga cgcgatggtc cgggaggcat gggaggatat gatggatctg      1080
     gccgaccgga tgcatcctcc gccaccgcga tga                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page