(data stored in ACNUC7421 zone)

EMBL: AP010803.PE365

AP010803.PE365       Location/Qualifiers
FT   CDS_pept        complement(375798..376499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03650"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95199"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXW7"
FT                   /protein_id="BAI95199.1"
FT                   /translation="MRQWFFDLKAANRFTIGIDQTAVDWLSALLRHPSWQRWVFHPLQA
FT                   QLPNFDWKQAARHAFTEQFWPIFDYISGRRLRDTKARTKDLVARYASQEVFDPAALKAS
FT                   YDLTIQFATFIGRNSGLDFRRSKPDEYRWNGAPPALLALCALILFVSDWQLNTAIGKFA
FT                   QILTAPDPSDLLLGNVVGLNPFHDYAAWQMVVLAQEIAQQPTGVRVYDAELVRIEAELR
FT                   EAFRAWIQGQG"
     atgcggcaat ggttcttcga cctgaaggcg gcgaaccgct tcaccatcgg gattgaccag        60
     acggccgtcg actggctctc cgcgctccta cggcatccct catggcagcg atgggtcttc       120
     catcctctac aggcgcaact tcctaatttt gactggaagc aggcagcacg tcacgcattt       180
     accgagcagt tctggccaat tttcgattac atatccggca gacgtctcag ggacaccaaa       240
     gcgcgtacca aggatttggt ggcccgctat gcgagtcagg aggtgtttga cccagcggcg       300
     ctcaaggcga gctatgatct gaccatccag ttcgcgacct tcatcggacg taattccggg       360
     ctcgatttcc gccggtcgaa acccgacgaa tatcgctgga acggcgcacc gccggcgctg       420
     ctggccttgt gtgccctcat cctgttcgta tcggactggc agttgaacac ggcgatcggc       480
     aagttcgcac agatcctgac agcgcctgat ccgagcgatc tgctccttgg caatgtcgtc       540
     gggctgaatc ccttccacga ctatgcggct tggcagatgg tggtgctcgc ccaagaaatt       600
     gcccagcaac ccactggcgt ccgcgtctat gatgccgagc ttgtgcggat cgaggccgaa       660
     ctgcgcgaag ccttccgggc ttggatccaa ggccagggct ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page