(data stored in ACNUC7421 zone)

EMBL: AP010803.PE367

AP010803.PE367       Location/Qualifiers
FT   CDS_pept        complement(377013..378263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03670"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95201"
FT                   /db_xref="InterPro:IPR041229"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXW9"
FT                   /protein_id="BAI95201.1"
FT                   /translation="MIFAYGLAAVFVKHRIFMTGGDLTHTQAIELLDEAARELAEIRRG
FT                   KHYALWRDDKCRPLGDALRQVSPFDAYSDSWIFTGDGGGTIAHGRFGDWAIDRLVEKLE
FT                   PAAILAAFGEEIAGNVGHYSELSAILGVQLDTTVHLGDGVTLDAEPEDTFEGLIHRIPF
FT                   QMLPVPSGTSVLRHRYRVEPAFELRTAAPTGKSVTTPASPARDQVRQRVRLACLLASIG
FT                   PVELPFSLLQPDRASLFVAGDGNQAGRPFAAMPLVAFPVEGAAVKRAYGYLATFRGGAS
FT                   MARAIDRLGRSRLAINPVDRALDLGMAAEIALMHDHSHNNTEIAHKIGSRSAWLLGQTP
FT                   TDRATIFTEMKSLYGARSQAVHSGFLSSRSTIDLDAADALVTRIFNAILARGAFPDWSS
FT                   LVMGGDALQPVEDEDGA"
     atgatctttg cctacgggct ggcagcggtg ttcgtcaaac accgcatatt tatgacggga        60
     ggggatttga cgcacactca agcgatagaa ctgctcgacg aagccgcgcg agaactggcc       120
     gaaattcgtc gtgggaagca ctatgctttg tggcgcgacg acaaatgtcg ccctcttggc       180
     gacgcccttc gacaagtctc gccgttcgac gcctatagcg acagctggat tttcactggc       240
     gatggcggcg gaacgatagc gcatggccgg ttcggcgatt gggcgattga tcgtttggtc       300
     gagaagctcg aaccagcggc gattcttgct gcctttggcg aagaaatcgc cggcaatgtc       360
     gggcattatt ccgaattgag cgctatcctc ggcgtgcaac tggacaccac cgtccacctg       420
     ggcgacggcg tgactctgga tgccgagccg gaagacactt tcgaaggcct gatccaccgc       480
     atcccattcc aaatgttgcc cgtgccgtca gggacgagcg tgctgcgcca tcgataccgg       540
     gtcgagcccg cgttcgaact ccgcaccgcc gccccgaccg gcaagagtgt aacgacacca       600
     gcgtcgccgg cccgagatca ggtgcgccag cgagtgcgcc tggcgtgcct cctcgccagc       660
     atcggtccgg tcgagctgcc attttcgttg ctgcagcccg atcgcgcgag cctgtttgtt       720
     gccggagacg gcaatcaggc cggccgcccg ttcgccgcga tgccgttggt cgcattcccg       780
     gtcgagggtg cggcagtcaa acgggcctat ggctatctcg caaccttccg gggcggcgcc       840
     agcatggcgc gcgcgataga ccgtttgggg cgttcgcgtc tggcgatcaa cccggtggat       900
     cgcgcgctcg acctcggcat ggcggcggaa atcgcgctga tgcacgatca cagccacaat       960
     aataccgaaa ttgcccataa gatcggcagc cgctcggcat ggctcctcgg ccagacgccg      1020
     accgaccggg cgacgatctt caccgaaatg aaatcgctct atggagcccg gtcacaagcg      1080
     gtgcattccg gctttttgtc gtcacgatcg accatagacc tcgatgctgc cgatgcgctc      1140
     gtcacacgca tctttaatgc gatcctcgcg cgtggcgcct ttccggattg gtctagcctg      1200
     gtgatgggcg gagatgcctt gcaaccggtg gaggacgaag atggcgccta a               1251
//

If you have problems or comments...

PBIL Back to PBIL home page