(data stored in SCRATCH zone)

EMBL: AP010803.PE368

AP010803.PE368       Location/Qualifiers
FT   CDS_pept        378483..379403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03680"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95202"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXX0"
FT                   /protein_id="BAI95202.1"
FT                   /translation="MIALGPSHHAHHLSGPFWWSLRGVATIYSLLSSNLKPTLGFAHQT
FT                   ASQRKADAFLLGEALTHWFAQTHLGAHMVVPLEAHTGFVVPHSTTAPYPKPMPKYFRHG
FT                   VKPGAKSEPDFLAFAGPGQIHVIESKGRAGFGHFGVADHVINAARNKALRQVCRIASVN
FT                   GIPPMTRTACVFAFDQSGLTGQITDPPANRPYHYRAEWPDLVRQAYASVLDPLFESSAR
FT                   DIGGNYVGIEFMPGWKFGIDRHVYKLVRSVEDAATMGRLLTFLSNFTSETDGVRIAEEY
FT                   SAGSDGLLLIGGPDFSTKGMRGALA"
     ttgatcgcac tcggccccag ccaccatgcg catcatctga gcgggccatt ctggtggtcg        60
     ctgcgcgggg tcgcgaccat ctatagcctt ttgtcatcga acctgaaacc gacgcttggg       120
     ttcgcccatc agacggcctc gcagcgcaag gctgacgcgt ttctgctggg cgaggccctt       180
     acccattggt tcgcgcagac ccatcttggc gcgcatatgg tcgtgcccct tgaggcccac       240
     acgggcttcg ttgtcccgca ctcgaccacc gcgccctatc ccaagccaat gcccaaatat       300
     ttccggcacg gcgttaaacc cggcgcgaag tctgagcccg attttctcgc cttcgcaggc       360
     ccgggccaaa tacacgtcat cgagagcaaa ggccgggctg gtttcggcca ttttggcgtg       420
     gccgaccatg tgataaacgc tgcgcgcaac aaggcattgc gtcaggtatg ccgaattgcg       480
     tcggtcaatg gcatcccccc aatgacccgc accgcgtgcg tgttcgcctt cgatcaatcg       540
     ggcctgactg ggcagatcac cgatccgccc gcaaaccgcc cgtatcatta tcgtgcggaa       600
     tggccggacc tcgttcgcca agcctatgcg agcgtgctcg atccgctgtt cgaatcgtcg       660
     gcccgtgaca tcggcggcaa ctatgtcggc atagagttta tgccgggctg gaagttcggc       720
     atcgaccgtc acgtctacaa gctcgtgcgc agcgttgaag atgctgcgac catgggacga       780
     ctgcttacgt tcctgtccaa tttcacgtcc gagaccgatg gcgtgaggat cgccgaggaa       840
     tacagcgccg gatcggacgg cctcctgttg ataggaggcc ccgatttctc gacgaagggt       900
     atgcggggtg cgctggcgta g                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page