(data stored in ACNUC7421 zone)

EMBL: AP010803.PE37

AP010803.PE37        Location/Qualifiers
FT   CDS_pept        37147..38103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00370"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94871"
FT                   /db_xref="GOA:D4YWY9"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWY9"
FT                   /protein_id="BAI94871.1"
FT                   /translation="MGRWRAALGIAIAIATSPLAAQDRAALDPDDPPAVIRTIPSGDTR
FT                   ITIPIQIDGRGPWNFVVDTGSQRTVISRALAERLDLPLRERVTVISMTGRAEVDTVAVP
FT                   RLGFGKTVVDDIEAPVLEGEHIGAAGLLGLDGLHAKRLLLNFRTGRMEISSSKRSWRDP
FT                   NVIVVEARRRQGQLILLDSDVNGMQVSIILDTGTSISVGNMALMNKLVRKKKAPALELV
FT                   TLTSVTGETLSGQAGLIDRVRMGQVMLKEMPVMFADAQPFAELGLHDKPALLLGIDALK
FT                   VFDRVAIDFGRGKVDFLLPDTGLLDRKRLATAGRAAG"
     atgggacgct ggcgcgccgc tctgggcatc gcgatcgcga tcgccacttc tccccttgcg        60
     gcgcaggatc gagccgcgct cgatcccgat gatccgcctg cggtgatccg caccatcccc       120
     agcggcgata cccgcatcac catccctatc caaatcgacg gcagggggcc gtggaacttc       180
     gtggtcgaca ccggatcgca gcgcaccgtc atttcccgcg ccctggccga acggctcgac       240
     ctgcccctgc gggagcgggt gacggtgatc agcatgaccg gccgggcgga ggtggacact       300
     gtcgccgtcc cgcgcctggg cttcggcaag accgtggtgg acgatataga ggcgccggtg       360
     ctggaggggg agcatatcgg cgcggccggc ctgttgggac tggacggcct gcacgccaag       420
     cggctgctgc tgaatttccg cacgggccgg atggagatca gcagcagcaa gcggagctgg       480
     cgtgacccca atgtcatcgt cgtcgaggcg cgacggcgcc aggggcagtt gatcctgctc       540
     gattccgacg tgaacggcat gcaggtcagc atcatcctgg acaccggcac ctccataagc       600
     gtcggcaaca tggcgttgat gaacaagctg gtgcgcaaga agaaggcgcc cgcgctggaa       660
     ctggtgacgc tgaccagcgt gacgggggag acgctgtcgg ggcaggccgg cctgatcgac       720
     cgggtgcgca tgggccaggt catgctgaag gagatgccgg tgatgttcgc cgatgcccag       780
     cccttcgcgg aactggggct tcacgacaag cccgcgctgc tgctcggcat cgacgcgctc       840
     aaggtgttcg accgggtggc catcgatttc gggcggggga aggtggactt cctgttgccg       900
     gacacagggc tgctcgaccg gaaacgcctt gcgacggcgg ggagagcggc gggttag          957
//

If you have problems or comments...

PBIL Back to PBIL home page