(data stored in ACNUC7421 zone)

EMBL: AP010803.PE370

AP010803.PE370       Location/Qualifiers
FT   CDS_pept        complement(380034..380879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03700"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95204"
FT                   /db_xref="InterPro:IPR024524"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXX2"
FT                   /protein_id="BAI95204.1"
FT                   /translation="MLRAYIDDSVSNTGDRRLVLAALIQSEATWAAFEVDWRRALAEPP
FT                   AIGYFKMAEAQNRRDQFKGFSEKERNRKVHALADIVARHAPWGFHASVSTTDYRELIEP
FT                   AAPFPMRTPYFLLFYAIVFGVARMHEALSVSEPCDFIFDQHSGLDKKTLPMLNDMIATS
FT                   SGSWGGQISGSVRFADDKDEVAIQASDLLAWLIRREGDGQLPPGCDGLMDKLVIYGVNR
FT                   FADVDRAWLEQISAGFSEIPRANSIDKQGWREMIPIWEGGHAKALNDAVIAAGLYPPED
FT                   "
     atgctgagag cttatatcga cgattctgtt tccaatactg gcgaccgacg gctggtgctt        60
     gctgcactga ttcaaagtga ggcgacatgg gcggcgttcg aagtggattg gcgacgtgcg       120
     ctcgccgagc cgcccgcaat cggctatttt aagatggccg aggcgcagaa ccggcgcgac       180
     cagttcaagg ggttttccga gaaagaacga aaccgcaaag tccatgcgct cgccgacatc       240
     gtcgcccgtc atgcaccctg gggttttcac gcctcggtca gcacgactga ctatcgcgaa       300
     ttgatcgagc cagccgcgcc cttccctatg cgaacgccct atttcctgct gttctacgcg       360
     atcgtattcg gggtcgcgcg gatgcatgag gcgcttagcg ttagcgagcc gtgcgacttc       420
     atcttcgatc aacattccgg gctcgataag aagacactgc ctatgctcaa cgacatgatc       480
     gcgacctcaa gcggatcatg gggcggtcag atcagcggca gtgttcgctt tgccgacgac       540
     aaggacgagg tcgccatcca agcctcggat ttgctggctt ggctgattcg acgcgagggc       600
     gatggccaat taccgcccgg atgcgacgga ttgatggaca agctcgtcat ctacggcgtc       660
     aatcgttttg ccgacgtcga tagggcgtgg ctcgagcaga tcagcgctgg cttctcggaa       720
     atcccgcgcg cgaactccat cgacaaacag ggttggcggg aaatgattcc gatctgggag       780
     ggcggtcacg ccaaggcact gaacgatgcc gtcattgcag ccgggctcta cccacccgag       840
     gactag                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page