(data stored in ACNUC7421 zone)

EMBL: AP010803.PE371

AP010803.PE371       Location/Qualifiers
FT   CDS_pept        380956..381159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03710"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95205"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXX3"
FT                   /protein_id="BAI95205.1"
FT                   /translation="MLPSWQHPWFARQNLPVGNRSVLKGEVRIAALPDLAMENWRLSGK
FT                   EGSKAVMTLKVTESPLLLSRLP"
     atgctgccgt catggcagca tccttggttt gctcgtcaaa acctgcctgt cggcaaccgg        60
     tcagttttga agggcgaagt tcgaattgct gcccttccgg acctggcgat ggaaaattgg       120
     cgcctgagcg gcaaggaagg gtcgaaagcg gtgatgacgc tcaaggtaac tgagagtccg       180
     cttctccttt cccgccttcc ataa                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page