(data stored in ACNUC7421 zone)

EMBL: AP010803.PE375

AP010803.PE375       Location/Qualifiers
FT   CDS_pept        384148..385011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03750"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03750"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95209"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXX7"
FT                   /protein_id="BAI95209.1"
FT                   /translation="MTMANALFLPPTEYLRHMLVRRIQNVFNDRDRGERPVVRSDNALY
FT                   PRQSVIWRVHGDVTTMMIGGVTALLLQMLHPAALAGVWDHSGFRGDMLGRLRRTARFIA
FT                   VTTFGDRAEAEAAIDRVRQVHERVKGVLPDGTPYAATDPRLLAWVHVCEAMGFLDAWIA
FT                   FAEPGMSRANQDRYFKQAAQIARALGADPVPESRAEAEALMTSFLPELKADTRTRAVAR
FT                   MILSQPAPSTAMRPAQSMLMQASVDILPPWAKQLHGFPARPLASPLVRASAFIIAHTLR
FT                   WAFNRS"
     atgaccatgg ccaacgctct atttctgccg ccgacagaat atctgcggca tatgctggtc        60
     cggcggatac agaatgtctt caatgaccgg gatcgtggcg aaaggccggt tgtgcgttcc       120
     gacaacgccc tctatccgcg ccagtctgtg atctggcgcg tgcatggcga tgtgacgacg       180
     atgatgatag gcggcgtaac cgccttgctg ctccagatgt tgcacccagc agcactggcc       240
     ggcgtctggg accatagcgg ctttcgcggc gacatgctgg gccggttgcg gcgcaccgcc       300
     cgcttcatcg ccgtcaccac ctttggcgat cgggccgaag cggaagcggc catcgatcgg       360
     gtgcgtcagg tgcatgaacg cgtgaagggc gtccttcccg atggcacgcc ctatgccgcc       420
     acagatccac gtctgctcgc ctgggtccat gtctgcgaag cgatgggttt tctcgacgcc       480
     tggatcgcct ttgccgaacc gggcatgagc cgtgcgaatc aggaccgcta ttttaaacag       540
     gcggcgcaga tcgcccgcgc actgggcgct gatccggtgc ccgaaagccg cgcggaggct       600
     gaagcgctga tgacatcgtt cctgccggag ttgaaggccg atacccgcac ccgcgccgtc       660
     gcccgcatga tcctgtcgca accggcgcca tccacggcga tgaggcctgc ccagtccatg       720
     ctgatgcagg cgtcggtcga tatattgccg ccttgggcaa aacagttgca tggcttcccg       780
     gcacggccgc tggcgtcacc cttagttcgg gcaagtgcct tcatcattgc ccacacacta       840
     cgttgggcct tcaaccgcag ttga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page